KEGG   Methanohalobium evestigatum: Metev_1697Help
Entry
Metev_1697        CDS       T01261                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev00051  Fructose and mannose metabolism
mev00562  Inositol phosphate metabolism
mev01100  Metabolic pathways
mev01110  Biosynthesis of secondary metabolites
mev01120  Microbial metabolism in diverse environments
mev01130  Biosynthesis of antibiotics
mev01200  Carbon metabolism
mev01230  Biosynthesis of amino acids
Module
mev_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mev_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_1697
   00051 Fructose and mannose metabolism
    Metev_1697
   00562 Inositol phosphate metabolism
    Metev_1697
Enzymes [BR:mev01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metev_1697
Exosome [BR:mev04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metev_1697
  Exosomal proteins of bladder cancer cells
   Metev_1697
  Exosomal proteins of melanoma cells
   Metev_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG Hydrolase_like NMO His_biosynth FMN_dh IGPS PcrB PRT_C
Motif
Other DBs
NCBI-ProteinID: ADI74536
JGI: Metev_1697
UniProt: D7EB19
Position
complement(1695365..1696042)
Genome map
AA seq 225 aa AA seqDB search
MNSSKSPLIVVNLKTYLQGTGEKAVTIAKACKNVSEKYNVDIGVSPQFCDIYQVASQVDV
PVYSQHIDGIDGGSHTGQILAQCVKDAGAIGTLVNHSERRLTLADIDSSVKAAGKAGLST
IVCTNNVNTSASAASLGPDYIAIEPPELIGTGVPVSSADPQVVKGSVDAVKNVNEDVKVL
CGAGISKGEDLQAALELGSAGVLLASGVVKAEDPEKALEHLVSQI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgagtaaatcacctctaatagtggtaaacctaaagacctatctacagggtaca
ggagaaaaagccgtaacaattgcaaaagcctgcaaaaatgtatcagaaaaatataatgtg
gatataggtgtatcaccccaattctgtgatatataccaggtggcttcacaggtggatgtt
cctgtttattcacagcacatcgatggaattgatggaggaagtcacacaggtcagattttg
gctcaatgtgtaaaagatgctggtgcaatcggtacactggtaaatcattccgagcgacgg
ttaacacttgcagatattgattcttcggtaaaagccgctggtaaagcgggtctttctact
atagtctgtactaataatgtaaatacaagcgcatcagcagcatcccttggacccgattat
atagcaatagaaccaccagaactaataggtactggggtaccagtgtcaagtgcagatcct
caggtggttaaaggttcagtagatgcagttaaaaatgtaaatgaagatgtgaaagtactc
tgtggtgcaggaatatccaaaggagaggacttgcaggctgctcttgagcttggatctgca
ggagttttactggcatcaggtgttgtcaaagcggaagaccctgaaaaagccttagaacac
cttgtaagccagatttaa

DBGET integrated database retrieval system