KEGG   Methanohalobium evestigatum: Metev_1697Help
Entry
Metev_1697        CDS       T01261                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metev_1697
   01230 Biosynthesis of amino acids
    Metev_1697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_1697
   00051 Fructose and mannose metabolism
    Metev_1697
   00562 Inositol phosphate metabolism
    Metev_1697
Enzymes [BR:mev01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metev_1697
Exosome [BR:mev04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metev_1697
  Exosomal proteins of bladder cancer cells
   Metev_1697
  Exosomal proteins of melanoma cells
   Metev_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1695365..1696042)
Genome map
AA seq 225 aa AA seqDB search
MNSSKSPLIVVNLKTYLQGTGEKAVTIAKACKNVSEKYNVDIGVSPQFCDIYQVASQVDV
PVYSQHIDGIDGGSHTGQILAQCVKDAGAIGTLVNHSERRLTLADIDSSVKAAGKAGLST
IVCTNNVNTSASAASLGPDYIAIEPPELIGTGVPVSSADPQVVKGSVDAVKNVNEDVKVL
CGAGISKGEDLQAALELGSAGVLLASGVVKAEDPEKALEHLVSQI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgagtaaatcacctctaatagtggtaaacctaaagacctatctacagggtaca
ggagaaaaagccgtaacaattgcaaaagcctgcaaaaatgtatcagaaaaatataatgtg
gatataggtgtatcaccccaattctgtgatatataccaggtggcttcacaggtggatgtt
cctgtttattcacagcacatcgatggaattgatggaggaagtcacacaggtcagattttg
gctcaatgtgtaaaagatgctggtgcaatcggtacactggtaaatcattccgagcgacgg
ttaacacttgcagatattgattcttcggtaaaagccgctggtaaagcgggtctttctact
atagtctgtactaataatgtaaatacaagcgcatcagcagcatcccttggacccgattat
atagcaatagaaccaccagaactaataggtactggggtaccagtgtcaagtgcagatcct
caggtggttaaaggttcagtagatgcagttaaaaatgtaaatgaagatgtgaaagtactc
tgtggtgcaggaatatccaaaggagaggacttgcaggctgctcttgagcttggatctgca
ggagttttactggcatcaggtgttgtcaaagcggaagaccctgaaaaagccttagaacac
cttgtaagccagatttaa

DBGET integrated database retrieval system