KEGG   Methanohalobium evestigatum: Metev_1835Help
Entry
Metev_1835        CDS       T01261                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev00020  Citrate cycle (TCA cycle)
mev00620  Pyruvate metabolism
mev00640  Propanoate metabolism
mev00650  Butanoate metabolism
mev00680  Methane metabolism
mev00720  Carbon fixation pathways in prokaryotes
mev01100  Metabolic pathways
mev01120  Microbial metabolism in diverse environments
mev01130  Biosynthesis of antibiotics
mev01200  Carbon metabolism
Module
mev_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_1835
   00020 Citrate cycle (TCA cycle)
    Metev_1835
   00620 Pyruvate metabolism
    Metev_1835
   00640 Propanoate metabolism
    Metev_1835
   00650 Butanoate metabolism
    Metev_1835
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metev_1835
   00680 Methane metabolism
    Metev_1835
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metev_1835
Enzymes [BR:mev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metev_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADI74670
JGI: Metev_1835
UniProt: D7EBF3
Position
complement(1846816..1847364)
Genome map
AA seq 182 aa AA seqDB search
MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRL
RSQIYEPDYVIVQDPTLIDIVDVAHGMDENGIVIINSDFNPEDFNIDTDAKIMTVDATKI
ALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGKIGDKNAEAVQKAYDMIREG
NI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatacgagtacatggtcgaggaggacaaggatccgttactgctgctgaattg
cttgcaatagcagctttcagtgatggtaaatttagccaggcttttccgtcttttggagtt
gagcgtagaggtgcaccagtacaggcgtttaccagaataggggataaacccataagattg
agaagccagatatatgaaccagattatgttatagtccaggaccctacgcttatcgacatc
gtcgatgttgcacatggtatggatgaaaacggaattgtaataataaacagcgattttaat
cctgaagatttcaatattgatacagatgctaaaataatgacagtcgatgctacaaaaatc
gcactggatatcatcggtcgaccgattgtaaatacaatacttctgggggcttttgcagga
gcaacagatgaaataaaccctgaatcaattaaagaagctgttaaagagagattccccgga
aagataggtgataaaaacgctgaagcagtacaaaaagcctacgatatgataagggagggc
aatatataa

DBGET integrated database retrieval system