KEGG   Methanohalobium evestigatum: Metev_1835Help
Entry
Metev_1835        CDS       T01261                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mev01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mev00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mev00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mev00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mev00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mev00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mev00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1846816..1847364)
Genome map
AA seq 182 aa AA seqDB search
MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRL
RSQIYEPDYVIVQDPTLIDIVDVAHGMDENGIVIINSDFNPEDFNIDTDAKIMTVDATKI
ALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGKIGDKNAEAVQKAYDMIREG
NI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatacgagtacatggtcgaggaggacaaggatccgttactgctgctgaattg
cttgcaatagcagctttcagtgatggtaaatttagccaggcttttccgtcttttggagtt
gagcgtagaggtgcaccagtacaggcgtttaccagaataggggataaacccataagattg
agaagccagatatatgaaccagattatgttatagtccaggaccctacgcttatcgacatc
gtcgatgttgcacatggtatggatgaaaacggaattgtaataataaacagcgattttaat
cctgaagatttcaatattgatacagatgctaaaataatgacagtcgatgctacaaaaatc
gcactggatatcatcggtcgaccgattgtaaatacaatacttctgggggcttttgcagga
gcaacagatgaaataaaccctgaatcaattaaagaagctgttaaagagagattccccgga
aagataggtgataaaaacgctgaagcagtacaaaaagcctacgatatgataagggagggc
aatatataa

DBGET integrated database retrieval system