KEGG   Methanohalobium evestigatum: Metev_1886Help
Entry
Metev_1886        CDS       T01261                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00010  Glycolysis / Gluconeogenesis
mev01100  Metabolic pathways
mev01120  Microbial metabolism in diverse environments
mev01200  Carbon metabolism
mev01230  Biosynthesis of amino acids
Module
mev_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mev_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metev_1886
Enzymes [BR:mev01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Metev_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C Pico_P2A
Motif
Other DBs
NCBI-ProteinID: ADI74717
JGI: Metev_1886
UniProt: D7EA46
Position
1898986..1900989
Genome map
AA seq 667 aa AA seqDB search
MSVSEEKKNYKVRSLSLNPCDKTKTVSFVDKDIVGPVDWGLKNHFDYRSYEYSEYSKNNV
LCFGLGKLAGSKLPGTQRLIFSFRSPLWKGFFVSALGGAAHVFKRVGVDYVTIEGRSEKP
SIIVLKGRKEGYVDVEFHEITENKLLNVYKGYNGKEGVYALSEYLISNFSSKYNNDYRCM
VVGPGSLYSNMGATFSATLKNNEMVVGSEEWAGRGGSGSVLYQGHGVAGIVFGGEMERIF
PGVDLSDLDNVKDILDTYYNESYIKVIKKRTTKYRYNPKIESGGTFGSNIHCLGEFIPLM
NWKMIYMPRDERINIHEKLLDKYWKPFNKESMEPRNWTTCGEPCPVVCKKHRKGQHVDYE
PYEADGPLAGSYEIHKTDVSVKKIDTIGIDAIEFGNLSAWILELISERLLSSKELGLSAN
PRFDMKNFDYEKDSEINANLVAELADNVAYGKTEVCKVLRQGIRKSASKFDEMFKERIKN
HSSGYNSYKDFAVYVPFGEDGCIAPTMYWAVGNFVPVPIQGKYLTYYQFGFFDPETLAEE
CFKKAVYELYSENTGMCRFHRNWATEVIPLLLKKAWDIDIDKSHNEEIIKKMVEYDKKAG
IKPSFWDSHRVLDIVAYGAKEFGNMKWWNEFENDKINTARKYWEMFLKSYEDKLGISWDY
DYQIKQK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtttcagaagaaaagaaaaactacaaggttaggtcgctatccctaaacccttgt
gataaaaccaaaaccgttagttttgttgataaagatatagtaggaccggtggactgggga
ttgaagaaccattttgactacagaagttatgaatactcagaatatagtaaaaacaatgta
ttgtgttttggtctgggtaaacttgctggaagcaaacttcccggtactcaaagattaata
ttttccttccgttcaccgctttggaaaggtttttttgtttctgcactgggtggtgcagca
catgtattcaaaagagtgggtgttgattatgtaacaattgaagggaggtcagaaaaacca
tcaatcatagtactaaaaggcagaaaagaaggatatgtagatgtagagtttcacgaaatt
acagaaaacaaattgctaaatgtctacaaaggatacaatggtaaagaaggtgtttacgca
ttatctgaatatttaataagcaacttttcatccaagtataataatgattatagatgtatg
gtcgttggtcctggttctttatattccaacatgggcgcaacattttcagccactttaaaa
aacaatgaaatggttgtaggttctgaagaatgggctggtagaggagggagcggctctgtt
ttatatcagggccatggtgttgccggcattgtttttggaggagaaatggaaagaatattc
cctggtgtagacctttcagatttggataacgtcaaggatattcttgacacatattacaat
gaatcatatataaaggtcatcaaaaaaagaaccaccaaatacagatataatccaaaaata
gaaagtgggggcacatttggttccaatattcattgtctgggtgaattcatacccttaatg
aactggaaaatgatttacatgcccagagatgaaaggataaacatccatgaaaaattgtta
gataaatactggaaaccattcaacaaagaatctatggaaccaagaaactggactacctgt
ggagagccctgtcctgtggtatgtaaaaaacatcgtaaaggacaacatgttgattatgag
ccttacgaagcagatggtcctctggctggttcatatgagattcacaaaacggatgtctcg
gtaaaaaaaatcgatactatagggattgatgccatagagtttggcaatctttcagcatgg
atacttgaactgatatctgaaaggctcttatcatcaaaagaacttggactatccgctaac
ccaagatttgacatgaaaaattttgattatgaaaaagattcagaaataaacgcaaatctc
gtagcagaacttgccgataatgtagcttatggtaaaactgaagtttgtaaagtcttgaga
cagggaataaggaaatccgccagcaaatttgatgagatgtttaaagaaagaattaaaaat
catagttctggttataatagctacaaagattttgcagtctatgtgcccttcggcgaagat
ggatgtatcgctccaactatgtactgggcagttggaaattttgtgcctgttccaatacag
ggtaaatatctcacctattatcagtttggatttttcgacccagaaactctggcagaagaa
tgtttcaaaaaagctgtatatgaactctattctgaaaataccgggatgtgtagatttcac
agaaattgggcaaccgaggtcataccattgcttttgaaaaaagcatgggatattgacata
gataaaagccacaatgaagaaattattaaaaaaatggtagaatacgataaaaaagccggg
ataaaaccttcgttctgggacagccacagagttttggatattgttgcttatggtgcaaaa
gaattcggcaacatgaaatggtggaatgaatttgaaaatgacaaaattaataccgccaga
aaatactgggagatgtttttaaaatcctatgaagacaaactgggtatatcatgggactat
gactatcagattaaacaaaaataa

DBGET integrated database retrieval system