KEGG   Methanohalobium evestigatum: Metev_1932Help
Entry
Metev_1932        CDS       T01261                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_1932
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_1932
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metev_1932
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metev_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1945217..1946437
Genome map
AA seq 406 aa AA seqDB search
MYHLECIECGKRYTESDVVYTCGECNGLLDVIYDYSTIELDMNKLKKQCPSVWKYREILP
IDETQEPISIEEGGTPLYRCDRLADKIGIKGLYVKHEGLNPTGSFKDRGMTVGVSKAIEL
GMKTVACASTGNTSASLGIYGARAGIPAVVLLPEGKVALGKVAQALMHGAKVLSVRGNFD
EALVLVRQLCDDEKFYLLNSVNPYRLEGQKTIGFEIIDQLGFNVPERVVLPVGNAGNITA
IYKGFKEFMNIGITDKVPRMTGIQSEGAAPIVDAYRNGRDDITPEKNPDTIATAIRIGNP
VNAKKALKAIYESNGMADTVTDDEIVQAQRDLAQLEGIGVEPASASSVAGLKKLVNDGII
GKDETVVCVTTGHLLKDPQEVVDVCPKPVVVDATMESIRNAVFSDK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctagaatgtattgaatgcggaaaaaggtacaccgaatcagatgtagtatac
acctgcggtgaatgtaacgggttgcttgatgtcatttatgattattccaccattgagctg
gacatgaacaaactcaaaaaacaatgtccatcagtatggaaataccgggaaatacttcct
atagatgaaacacaggaaccaatatccattgaagaaggaggtacccctctttatagatgt
gaccgtcttgctgataaaatcggtataaaaggtctttatgtaaaacatgagggactgaac
cctacaggttcatttaaagacagaggtatgaccgttggtgtatcaaaagccattgaactt
ggtatgaaaactgttgcatgtgcatcgacaggtaacacttctgcatcactcggcatctat
ggtgcaagagctggaattcctgcggttgtgctgttaccagaaggcaaagttgctcttggt
aaagttgctcaggctttgatgcatggtgccaaagttttgagtgtaagaggcaattttgat
gaggctctggtactggtacgccagttatgtgacgatgaaaaattctatctgttaaactct
gtcaacccctacaggctcgaggggcaaaaaacaatcggctttgaaattatcgaccagctg
ggttttaatgttcctgaaagagtagtactgccagttggaaacgctggaaatatcacagct
atttataagggttttaaagaattcatgaacataggtataactgataaagtcccccggatg
accggtatccagtccgaaggtgccgctccgattgtagatgcctatagaaatggaagggat
gatatcacaccagaaaagaaccctgatacgattgcaaccgcgatacgtatcggaaaccct
gtaaatgcaaagaaggcattgaaggctatatacgaatccaatggaatggcggatactgtc
accgatgatgagattgtacaggctcaaagagacctcgcccaacttgagggcataggcgtt
gaaccagcaagtgcatcatctgtagcaggacttaaaaaactggttaatgatgggataatt
ggaaaagacgaaactgtggtatgtgttacaacaggtcatctactcaaagacccccaggaa
gtagttgatgtatgtccaaaaccagtggttgtggatgctacgatggaatcgattagaaat
gcggtgttttcggataaataa

DBGET integrated database retrieval system