KEGG   Methanohalobium evestigatum: Metev_1932Help
Entry
Metev_1932        CDS       T01261                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mev  Methanohalobium evestigatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metev_1932
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metev_1932
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metev_1932
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metev_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1945217..1946437
Genome map
AA seq 406 aa AA seqDB search
MYHLECIECGKRYTESDVVYTCGECNGLLDVIYDYSTIELDMNKLKKQCPSVWKYREILP
IDETQEPISIEEGGTPLYRCDRLADKIGIKGLYVKHEGLNPTGSFKDRGMTVGVSKAIEL
GMKTVACASTGNTSASLGIYGARAGIPAVVLLPEGKVALGKVAQALMHGAKVLSVRGNFD
EALVLVRQLCDDEKFYLLNSVNPYRLEGQKTIGFEIIDQLGFNVPERVVLPVGNAGNITA
IYKGFKEFMNIGITDKVPRMTGIQSEGAAPIVDAYRNGRDDITPEKNPDTIATAIRIGNP
VNAKKALKAIYESNGMADTVTDDEIVQAQRDLAQLEGIGVEPASASSVAGLKKLVNDGII
GKDETVVCVTTGHLLKDPQEVVDVCPKPVVVDATMESIRNAVFSDK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatctagaatgtattgaatgcggaaaaaggtacaccgaatcagatgtagtatac
acctgcggtgaatgtaacgggttgcttgatgtcatttatgattattccaccattgagctg
gacatgaacaaactcaaaaaacaatgtccatcagtatggaaataccgggaaatacttcct
atagatgaaacacaggaaccaatatccattgaagaaggaggtacccctctttatagatgt
gaccgtcttgctgataaaatcggtataaaaggtctttatgtaaaacatgagggactgaac
cctacaggttcatttaaagacagaggtatgaccgttggtgtatcaaaagccattgaactt
ggtatgaaaactgttgcatgtgcatcgacaggtaacacttctgcatcactcggcatctat
ggtgcaagagctggaattcctgcggttgtgctgttaccagaaggcaaagttgctcttggt
aaagttgctcaggctttgatgcatggtgccaaagttttgagtgtaagaggcaattttgat
gaggctctggtactggtacgccagttatgtgacgatgaaaaattctatctgttaaactct
gtcaacccctacaggctcgaggggcaaaaaacaatcggctttgaaattatcgaccagctg
ggttttaatgttcctgaaagagtagtactgccagttggaaacgctggaaatatcacagct
atttataagggttttaaagaattcatgaacataggtataactgataaagtcccccggatg
accggtatccagtccgaaggtgccgctccgattgtagatgcctatagaaatggaagggat
gatatcacaccagaaaagaaccctgatacgattgcaaccgcgatacgtatcggaaaccct
gtaaatgcaaagaaggcattgaaggctatatacgaatccaatggaatggcggatactgtc
accgatgatgagattgtacaggctcaaagagacctcgcccaacttgagggcataggcgtt
gaaccagcaagtgcatcatctgtagcaggacttaaaaaactggttaatgatgggataatt
ggaaaagacgaaactgtggtatgtgttacaacaggtcatctactcaaagacccccaggaa
gtagttgatgtatgtccaaaaccagtggttgtggatgctacgatggaatcgattagaaat
gcggtgttttcggataaataa

DBGET integrated database retrieval system