KEGG   Methanohalobium evestigatum: Metev_2033Help
Entry
Metev_2033        CDS       T01261                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mev  Methanohalobium evestigatum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metev_2033
Enzymes [BR:mev01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Metev_2033
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Metev_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2034155..2034922
Genome map
AA seq 255 aa AA seqDB search
MKLEAFTVDNIPLIKKGDDLAEIISNNIELDDGDIAVIASTIVAKSEGQVFKLEDINPSE
NAVRIANKNRFNPAFVQAVLNRSRECLVESPIMLVETYNGNVCINAGIDDSNIEKGFILD
LPENPDESAELIGSRLKELTGKQLGVIITDTNGRAFKTGQTGVAVGVYQLPAIKNWRGET
DLYGHALEITEEAVADEIAGTANLLMGEGDGGNPVIIVRGMNILTEEKRTVKEMHRPDDE
DIIKKGLRCLNQSNS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagaagcgtttactgtagataatatacccctgattaaaaagggcgatgatctt
gcagaaataataagtaataacatcgagttagatgacggagatattgctgtaatcgcttcc
acaattgtagccaaatccgaaggtcaggtattcaaacttgaagatataaatccttctgaa
aacgcagtaagaattgcaaacaaaaaccgttttaatcctgcttttgtacaggcggttctt
aacagaagtagagaatgccttgtcgaatccccaataatgcttgttgaaacatataatgga
aacgtctgtataaatgctggaatagatgactcaaatatagaaaaaggttttattcttgac
ctgccggaaaaccccgatgaaagtgctgaactgattggttcacgtcttaaagaacttacc
ggcaaacagttaggagtaatcattactgatacaaacggcagggcttttaaaaccggacag
acaggcgtagcagtgggtgtatatcaacttccagcaatcaaaaactggcgcggtgaaaca
gacctttacggtcatgctcttgaaatcacagaagaggctgttgcggatgaaattgccggt
actgccaatttgttgatgggagaaggagacggtggtaaccctgtgataattgtaagaggg
atgaatatcttaaccgaggaaaaaagaacggttaaagagatgcatcgtccagacgacgaa
gatataatcaaaaagggtttacgctgtttgaatcagtcaaattcctga

DBGET integrated database retrieval system