KEGG   Methanohalobium evestigatum: Metev_2038Help
Entry
Metev_2038        CDS       T01261                                 

Definition
ELP3 family histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mev  Methanohalobium evestigatum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2039257..2040900
Genome map
AA seq 547 aa AA seqDB search
MSENTDDFNRVCRQLLEMVLDGTITSNTELNKAKKRLSSAYRFSSLPRNSDIITVGTEEE
QKQAMEILRRKPVRTISGVAVVAAMTSPAPCPHGVCVPCPGGPDSEFNSPQSYMGLEPAT
RRAIRNEYDPYKLVTSRLSQLKEIGHDVDKAELIVMGGTFTSRSIDYQEWYTKKCIEAMN
DFYDTSWRNNAHTIGKTQPYIPLEEVQKANENAPIRNIGITFETRPDWTNTQHIDRILEL
GATKVEIGVQSVYDFVLSRINRGHTVNDTAEANRMLRDSGLKVGFHMMPNLPGMGYEREL
RGFERLFDDSRFMPDYLKIYPTLVTEGTELYKMWERGEYTALDDDEAVELISDVKAMLPK
WVRLQRIQRDIPSQQIFAGVRKSNIRQLARERLQEKGGKCRCIRCREVGHNILKGIEPSD
ENIEFTVESYNSCGGVEHFLAFEDVKQDILIGFLRLRFPARPHRNELHDAAVVRELHVYG
SMAPFGSSENKYWQHRGYGSELLEQAEKISYNSGHKKLAIISGIGAREYYRKFGYHLDGV
YMSKRLY
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatacagatgattttaaccgggtgtgcagacaacttcttgaaatggtgctg
gatggtacaataaccagcaacacagaattgaacaaagccaagaaaagattgagttcagcc
tatcggttttcctcgcttccgagaaattcagacattataacggtgggtactgaagaagaa
caaaaacaggcaatggagatacttcgccgtaaacctgtacgcactatttccggtgtagca
gtggttgctgcaatgacctctcccgccccatgtcctcatggtgtatgtgtcccatgtccc
ggtggtccggattcagaatttaattccccccaaagctacatgggccttgaacctgcaacc
agacgtgctattcgtaatgaatacgacccatataaactggtcacatcgcgtttatcccag
ttaaaagaaatcggacacgatgtagacaaggctgaacttatcgttatgggtggtacattt
acatcaaggtctatagattatcaggaatggtataccaaaaaatgcattgaagcaatgaac
gatttctatgacacttcatggagaaataacgcccatacaatcggtaaaacccagccatat
atacctcttgaagaggtgcagaaggcaaatgaaaacgcccctataagaaacataggcata
acctttgaaaccagacctgactggacaaatactcaacatatagacagaatcttggaactg
ggtgctacaaaagtagaaatcggtgtccaaagtgtatacgattttgtactttcaaggatt
aatcggggacataccgtcaatgatactgctgaagcaaaccgtatgttaagagatagcggg
cttaaagttggatttcacatgatgccaaaccttccaggcatgggttatgagcgcgaactt
cgaggatttgagaggttgtttgatgattcgcggtttatgcctgattacctaaagatttat
ccaactcttgtaacagaaggtactgaactctataagatgtgggaaagaggtgaatacacc
gctcttgatgacgatgaagccgtagaactgatttcagatgttaaagcaatgcttccaaaa
tgggtgcgtttgcagagaatccagcgagatataccatcccagcagatatttgccggtgtt
agaaaaagcaatatccgccaacttgcaagagaacgtctccaggaaaaaggtggaaaatgc
cggtgtatcagatgcagggaagtgggacacaacatcctgaaaggtattgaacccagtgat
gaaaatatcgaatttactgtagaatcctacaattcctgtggaggagtagaacattttctt
gcttttgaagatgtaaaacaggacatactaataggattcctgaggcttcgatttcctgca
agaccccaccgaaatgaactgcatgatgcagctgttgtaagggaattgcatgtttatggt
tcaatggcaccgtttggaagttcagaaaataaatactggcagcacagaggttacggttcc
gaactgctcgaacaggcagagaaaatatcatataatagcggccacaaaaaactggcaatc
ataagtggtattggcgctcgcgaatattatcgaaaatttggatatcaccttgatggggtc
tacatgtcaaaacgtctttattaa

DBGET integrated database retrieval system