KEGG   Methanohalobium evestigatum: Metev_2062Help
Entry
Metev_2062        CDS       T01261                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mev  Methanohalobium evestigatum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metev_2062
Enzymes [BR:mev01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metev_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2061067..2061618
Genome map
AA seq 183 aa AA seqDB search
MWQEISRIGKKLVEHGLVESHFGNISVRVGNKMIITRSGCPLDEVTEGNVVEIDVDNPCS
MDIIASSESIVHREIYKNTSALAIIHAHCPYAVTQSLLNDKNSLVPVDSEGKYFLDEIPV
IKGDIGTEKLAYNTADALGKYKGTIVYSHGTFAAGKILDDAYITTTQIEHSCKIKYLYDM
AKK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaatatccagaataggcaaaaaacttgtagaacacgggcttgtggaatca
cattttggtaacattagtgttcgtgttggaaataaaatgataataacaagaagcggttgc
cctcttgacgaggtgacagaagggaatgtggttgaaattgatgttgacaatccctgcagc
atggatataatagcatcatcagaatccattgttcaccgggaaatctataaaaatacatca
gcacttgctataatccacgcacattgtccttatgctgtcacacaatcactacttaatgat
aaaaattcactggtaccagttgacagtgaggggaaatatttcctcgatgaaatacctgtt
atcaaaggagatataggcacagaaaaacttgcatacaacacagcagatgcactgggcaaa
tataaaggaacaattgtttacagtcatggtacatttgccgctggaaaaattctggatgat
gcctatataacaacaacccagatagaacactcctgcaaaataaaatacctgtatgatatg
gctaaaaaataa

DBGET integrated database retrieval system