KEGG   Methanohalobium evestigatum: Metev_2135Help
Entry
Metev_2135        CDS       T01261                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mev  Methanohalobium evestigatum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metev_2135
Enzymes [BR:mev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metev_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2131250..2131969)
Genome map
AA seq 239 aa AA seqDB search
MTYEIMKVAVTRLHEKDDGTYNLFKKYGLDAILIPTIQSREPSDKSSMQTLLKKLESRCI
DFLIFTSTLGVIKFFKWTTEIPDRTKIISVGPKTAEKINQYGYHTEVLDSYYSEHFATHL
GEKVSGKTVGITRANTPDSGLKQSLQSMGATVIEGFCYELVETPNELKDYIVDKKIDGVV
FTSTKSFLASKLTNSEVKDIITVAIGPKTAESMENHDITPTLVGSGTLDSCALLLKDIE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgaaattatgaaggttgccgtaacacgtttacatgaaaaagatgatggaaca
tacaatcttttcaaaaagtatggacttgatgcaattctaatacccaccatacaatcacgt
gagccttctgataaatcatctatgcaaactcttctaaaaaagttggaatcgcggtgtata
gattttctcatttttacaagtacacttggtgttatcaaatttttcaagtggactactgaa
attcctgatagaaccaaaataatcagtgtgggccccaaaacagcagaaaagataaaccag
tatggataccacacagaagttctggattcatactattctgaacattttgcaacacatctt
ggtgaaaaggtatcaggcaaaactgttggcatcaccagagcaaatacacctgattctggg
cttaaacaatctctgcagtcaatgggtgcaactgttattgaagggttctgttatgaactc
gtagaaacccctaatgaattgaaagattatatagtggataaaaaaatcgatggtgttgtt
tttacaagcacaaaatcttttctagcttcaaaacttacaaattctgaagtcaaagatatc
attacagtggcaattggaccaaaaacagctgaaagtatggaaaatcacgatataacaccc
actcttgtaggttcaggtacccttgattcatgtgctcttttgcttaaagatatagaataa

DBGET integrated database retrieval system