KEGG   Methanobacterium paludis: MSWAN_0018Help
Entry
MSWAN_0018        CDS       T01509                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mew  Methanobacterium paludis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSWAN_0018
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSWAN_0018
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSWAN_0018
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSWAN_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(19068..20360)
Genome map
AA seq 430 aa AA seqDB search
MYRVMLDEKDVPKKWYNIAADLPVELPAPTQTEEGHQLENLPKIFSKGVLEQEMSQERWI
EIPKEVREVYKKVGRPNPLYRATGLEDYLDTPAKIYYKREDLSPTGSHKLNSAIAQAYYA
KKDGAERLTTETGAGQWGTALSLACSLMGLDCTVYMVKSSFQQKPYRKTIMQIYDGEVLA
SPSDKTSYGRKKLAEDPNHPGSLGIAISEAVEDALSDDKTYYSLGSVLNHVMLHQTVIGL
ETKKQFESIDETPDVMVGCVGGGSNFSGAAFPFMKDKISGDLDCQFIAVEPESCPTLTQG
EYRYDYGDTEGLTPLLKMYTLGHEFIPPSNHAGGLRYHGMSPIIALLVHEGLMDARTVKQ
TEIFKTGQTFAKCEGVVPAPETCHAIKIGMDEAVKCRKTGEEKNIVINFSGHGLLDLQGY
SDFFEGKLED
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagttatgttagatgagaaggatgttccaaaaaaatggtacaacatagcagca
gacctacctgtggagcttccagcacctacacagacagaagaaggacatcaacttgaaaat
ttgccaaaaatattttcaaagggcgttttagaacaggaaatgtcccaagaaagatggata
gagattccaaaagaggtacgtgaagtttacaaaaaagtaggaagaccaaatccactttac
agggccaccggtcttgaagactacctggacactcctgcaaagatctactacaaacgtgaa
gatctctccccaaccggaagtcacaagcttaacagtgccatagcacaggcttactacgct
aaaaaagatggtgcagagaggcttacaacagaaactggtgcaggacaatggggtacagca
ttatcccttgcatgttctcttatgggacttgactgcactgtttatatggttaaatcttca
ttccagcagaaaccttacaggaaaactatcatgcagatctatgatggagaagttttggct
tcaccaagtgataaaacatcttatggaagaaaaaagctggctgaagatccaaaccatcca
ggttcccttggaatagccatatctgaagctgttgaagacgctttaagcgatgataagact
tattattctcttggaagtgttctaaatcatgtgatgctccatcagacagttatcggactt
gaaaccaagaaacagttcgagtcaatcgatgaaacacctgatgtaatggttggatgtgtt
ggtggaggaagtaacttcagtggtgcagctttcccattcatgaaggacaaaatatccgga
gacctggactgccagttcatagccgtagaacctgaatcctgcccaacactcacacaggga
gaatacagatacgactacggtgacacagaaggccttacacccctcttgaagatgtacaca
ttgggtcatgaattcataccaccatcaaatcatgcaggaggattaaggtaccacggaatg
tcccctataattgcattactcgtgcacgaaggactgatggatgcacgtacagtcaaacag
accgaaatcttcaaaacaggccagaccttcgcaaaatgtgaaggggttgtacctgcacct
gaaacctgtcacgccattaaaataggaatggatgaagcagttaaatgtaggaaaactggg
gaagagaaaaacatcgtcatcaacttctcaggccacggcctgctggaccttcaaggttac
agtgacttctttgaaggtaaattagaggattaa

DBGET integrated database retrieval system