KEGG   Methanobacterium paludis: MSWAN_0186Help
Entry
MSWAN_0186        CDS       T01509                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mew  Methanobacterium paludis
Pathway
mew00010  Glycolysis / Gluconeogenesis
mew00620  Pyruvate metabolism
mew00640  Propanoate metabolism
mew00680  Methane metabolism
mew00720  Carbon fixation pathways in prokaryotes
mew01100  Metabolic pathways
mew01110  Biosynthesis of secondary metabolites
mew01120  Microbial metabolism in diverse environments
mew01130  Biosynthesis of antibiotics
mew01200  Carbon metabolism
Module
mew_M00357  Methanogenesis, acetate => methane
mew_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_0186
   00620 Pyruvate metabolism
    MSWAN_0186
   00640 Propanoate metabolism
    MSWAN_0186
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_0186
   00680 Methane metabolism
    MSWAN_0186
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSWAN_0186
Lipid biosynthesis proteins [BR:mew01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSWAN_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SBP_bac_8
Motif
Other DBs
NCBI-ProteinID: AEG17232
JGI: MSWAN_0186
UniProt: F6D1K4
Position
213564..215252
Genome map
AA seq 562 aa AA seqDB search
MSHLLNKFVPKTEFESYKDFKENFRIEFPENFNFAFDVVDEYASKYPEKVGLVWCDDDQE
KIFTFRDLKNYSNKTANFLRQCGVEKGDRVILTLKSRYEFWFCLLALHKLGAIAIPATHM
LKTKDITYRITSAGISMAICITENGVPDYFDEAEAQLKDTKLLKAFVGDGEREGWFNLRE
GIEKASPEFERPKGDAETKVSDVSIGLFSSGTTGLPKMVNHSYTYPLGHIITAKYWQNVL
EDGLHYTIADTGWGKALWGQIYGQWIAGSAVFIYDYDRFDAAHVLDKASKHGVTTFCAPP
TIYRFLIKEDLSKYDFSNLQYVVTAGEPLNPEVYNKFYEFTGLKLREGFGQTETVASVAN
FPWIKPKPGSMGKPSPGYDVMLLDKEGKPCDVGEEGEICFRIHKRPIGLFTGYYRKPEKT
REACHGGYYHTGDTAWKDEDGYLWFVGRNDDIIKSSGYRIGPFEVESAVISHPSVLECAI
TGVPHPIRGQVIKATIVLAKGYKPSEELKKDIQNHVKGVTAPYKYPRVVEFVEELPKTIS
GKIKRVEIREKDLGNVSGGSET
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatttactgaataaatttgttccaaaaactgaatttgaatcatataaagatttt
aaagagaatttcaggatagaatttcccgaaaacttcaacttcgcctttgacgttgttgat
gaatatgccagtaagtaccctgagaaggttggccttgtctggtgtgatgatgatcaggag
aagatcttcaccttcagggaccttaaaaattacagcaacaaaacagccaacttcctcagg
caatgcggagtagaaaagggtgacagagttattttaacccttaaaagtcgatatgagttc
tggttctgcctgttggccttgcacaagttaggggcaatagcaatccctgcaactcacatg
ctaaaaaccaaggacataacctacaggataacaagtgcaggaatcagtatggctatctgc
ataacagaaaatggagtccccgactatttcgatgaggcagaggcacaactcaaggataca
aaacttttaaaagctttcgtgggtgatggagaacgtgaaggatggtttaatctacgtgaa
ggaattgaaaaagcttcaccagagtttgaaagacctaagggggatgctgaaacaaaagtt
tctgatgtttcaattgggttattctcatcaggaaccacaggactccctaaaatggttaac
cacagttatacctatcctcttggccacataatcacggcaaagtattggcaaaatgtttta
gaggatggattgcactacacgattgcagacactggatggggtaaggccctgtggggtcag
atatatgggcagtggattgcaggaagtgccgtatttatatacgattatgacagattcgac
gcagcccatgtcctggataaagcatcaaaacatggagttacaaccttctgtgcacctcca
acaatctatagattcctcataaaagaagatctttccaaatatgatttttcaaatcttcaa
tacgtggttacagccggtgaaccattgaatccggaggtttacaacaaattctatgagttc
acaggtttaaaattgagagaaggcttcggacagactgaaaccgttgcatctgttgctaac
ttcccatggatcaaacctaaacctggatcaatgggaaaaccatctccaggatatgatgtt
atgcttcttgacaaagagggaaaaccctgtgatgttggagaagaaggggagatatgtttc
agaatccataaaaggccaataggacttttcacaggttactaccgcaaacctgagaaaacg
agggaagcatgccacggaggttactaccacacaggagacacggcctggaaggatgaagat
ggctacctctggtttgtgggacgtaacgatgacataatcaaaagttcaggctacaggata
gggcctttcgaagttgagagcgccgtaatatcccatccttcagttcttgaatgtgcaata
acgggtgtaccccaccccataagggggcaggtgataaaggcaaccatagtacttgccaag
ggttataaaccttcagaagaacttaaaaaggatatacaaaaccatgttaaaggtgtaaca
gctccttataagtatccacgtgttgttgaatttgttgaagagcttccaaaaaccataagt
ggtaaaataaaacgtgtggaaataagggaaaaagatttgggaaatgtatctggtggttca
gaaacctag

DBGET integrated database retrieval system