KEGG   Methanobacterium sp. SWAN-1: MSWAN_0186Help
Entry
MSWAN_0186        CDS       T01509                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0186
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_0186
   00620 Pyruvate metabolism
    MSWAN_0186
   00640 Propanoate metabolism
    MSWAN_0186
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_0186
   00680 Methane metabolism
    MSWAN_0186
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSWAN_0186
Lipid biosynthesis proteins [BR:mew01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSWAN_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
213564..215252
Genome map
AA seq 562 aa AA seqDB search
MSHLLNKFVPKTEFESYKDFKENFRIEFPENFNFAFDVVDEYASKYPEKVGLVWCDDDQE
KIFTFRDLKNYSNKTANFLRQCGVEKGDRVILTLKSRYEFWFCLLALHKLGAIAIPATHM
LKTKDITYRITSAGISMAICITENGVPDYFDEAEAQLKDTKLLKAFVGDGEREGWFNLRE
GIEKASPEFERPKGDAETKVSDVSIGLFSSGTTGLPKMVNHSYTYPLGHIITAKYWQNVL
EDGLHYTIADTGWGKALWGQIYGQWIAGSAVFIYDYDRFDAAHVLDKASKHGVTTFCAPP
TIYRFLIKEDLSKYDFSNLQYVVTAGEPLNPEVYNKFYEFTGLKLREGFGQTETVASVAN
FPWIKPKPGSMGKPSPGYDVMLLDKEGKPCDVGEEGEICFRIHKRPIGLFTGYYRKPEKT
REACHGGYYHTGDTAWKDEDGYLWFVGRNDDIIKSSGYRIGPFEVESAVISHPSVLECAI
TGVPHPIRGQVIKATIVLAKGYKPSEELKKDIQNHVKGVTAPYKYPRVVEFVEELPKTIS
GKIKRVEIREKDLGNVSGGSET
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatttactgaataaatttgttccaaaaactgaatttgaatcatataaagatttt
aaagagaatttcaggatagaatttcccgaaaacttcaacttcgcctttgacgttgttgat
gaatatgccagtaagtaccctgagaaggttggccttgtctggtgtgatgatgatcaggag
aagatcttcaccttcagggaccttaaaaattacagcaacaaaacagccaacttcctcagg
caatgcggagtagaaaagggtgacagagttattttaacccttaaaagtcgatatgagttc
tggttctgcctgttggccttgcacaagttaggggcaatagcaatccctgcaactcacatg
ctaaaaaccaaggacataacctacaggataacaagtgcaggaatcagtatggctatctgc
ataacagaaaatggagtccccgactatttcgatgaggcagaggcacaactcaaggataca
aaacttttaaaagctttcgtgggtgatggagaacgtgaaggatggtttaatctacgtgaa
ggaattgaaaaagcttcaccagagtttgaaagacctaagggggatgctgaaacaaaagtt
tctgatgtttcaattgggttattctcatcaggaaccacaggactccctaaaatggttaac
cacagttatacctatcctcttggccacataatcacggcaaagtattggcaaaatgtttta
gaggatggattgcactacacgattgcagacactggatggggtaaggccctgtggggtcag
atatatgggcagtggattgcaggaagtgccgtatttatatacgattatgacagattcgac
gcagcccatgtcctggataaagcatcaaaacatggagttacaaccttctgtgcacctcca
acaatctatagattcctcataaaagaagatctttccaaatatgatttttcaaatcttcaa
tacgtggttacagccggtgaaccattgaatccggaggtttacaacaaattctatgagttc
acaggtttaaaattgagagaaggcttcggacagactgaaaccgttgcatctgttgctaac
ttcccatggatcaaacctaaacctggatcaatgggaaaaccatctccaggatatgatgtt
atgcttcttgacaaagagggaaaaccctgtgatgttggagaagaaggggagatatgtttc
agaatccataaaaggccaataggacttttcacaggttactaccgcaaacctgagaaaacg
agggaagcatgccacggaggttactaccacacaggagacacggcctggaaggatgaagat
ggctacctctggtttgtgggacgtaacgatgacataatcaaaagttcaggctacaggata
gggcctttcgaagttgagagcgccgtaatatcccatccttcagttcttgaatgtgcaata
acgggtgtaccccaccccataagggggcaggtgataaaggcaaccatagtacttgccaag
ggttataaaccttcagaagaacttaaaaaggatatacaaaaccatgttaaaggtgtaaca
gctccttataagtatccacgtgttgttgaatttgttgaagagcttccaaaaaccataagt
ggtaaaataaaacgtgtggaaataagggaaaaagatttgggaaatgtatctggtggttca
gaaacctag

DBGET integrated database retrieval system