KEGG   Methanobacterium sp. SWAN-1: MSWAN_0186Help
Entry
MSWAN_0186        CDS       T01509                                 

Definition
(RefSeq) butyrate--CoA ligase (EC:6.2.1.2)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0186
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_0186
   00620 Pyruvate metabolism
    MSWAN_0186
   00640 Propanoate metabolism
    MSWAN_0186
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_0186
   00680 Methane metabolism
    MSWAN_0186
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSWAN_0186
Lipid biosynthesis proteins [BR:mew01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSWAN_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
213564..215252
Genome map
AA seq 562 aa AA seqDB search
MSHLLNKFVPKTEFESYKDFKENFRIEFPENFNFAFDVVDEYASKYPEKVGLVWCDDDQE
KIFTFRDLKNYSNKTANFLRQCGVEKGDRVILTLKSRYEFWFCLLALHKLGAIAIPATHM
LKTKDITYRITSAGISMAICITENGVPDYFDEAEAQLKDTKLLKAFVGDGEREGWFNLRE
GIEKASPEFERPKGDAETKVSDVSIGLFSSGTTGLPKMVNHSYTYPLGHIITAKYWQNVL
EDGLHYTIADTGWGKALWGQIYGQWIAGSAVFIYDYDRFDAAHVLDKASKHGVTTFCAPP
TIYRFLIKEDLSKYDFSNLQYVVTAGEPLNPEVYNKFYEFTGLKLREGFGQTETVASVAN
FPWIKPKPGSMGKPSPGYDVMLLDKEGKPCDVGEEGEICFRIHKRPIGLFTGYYRKPEKT
REACHGGYYHTGDTAWKDEDGYLWFVGRNDDIIKSSGYRIGPFEVESAVISHPSVLECAI
TGVPHPIRGQVIKATIVLAKGYKPSEELKKDIQNHVKGVTAPYKYPRVVEFVEELPKTIS
GKIKRVEIREKDLGNVSGGSET
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatttactgaataaatttgttccaaaaactgaatttgaatcatataaagatttt
aaagagaatttcaggatagaatttcccgaaaacttcaacttcgcctttgacgttgttgat
gaatatgccagtaagtaccctgagaaggttggccttgtctggtgtgatgatgatcaggag
aagatcttcaccttcagggaccttaaaaattacagcaacaaaacagccaacttcctcagg
caatgcggagtagaaaagggtgacagagttattttaacccttaaaagtcgatatgagttc
tggttctgcctgttggccttgcacaagttaggggcaatagcaatccctgcaactcacatg
ctaaaaaccaaggacataacctacaggataacaagtgcaggaatcagtatggctatctgc
ataacagaaaatggagtccccgactatttcgatgaggcagaggcacaactcaaggataca
aaacttttaaaagctttcgtgggtgatggagaacgtgaaggatggtttaatctacgtgaa
ggaattgaaaaagcttcaccagagtttgaaagacctaagggggatgctgaaacaaaagtt
tctgatgtttcaattgggttattctcatcaggaaccacaggactccctaaaatggttaac
cacagttatacctatcctcttggccacataatcacggcaaagtattggcaaaatgtttta
gaggatggattgcactacacgattgcagacactggatggggtaaggccctgtggggtcag
atatatgggcagtggattgcaggaagtgccgtatttatatacgattatgacagattcgac
gcagcccatgtcctggataaagcatcaaaacatggagttacaaccttctgtgcacctcca
acaatctatagattcctcataaaagaagatctttccaaatatgatttttcaaatcttcaa
tacgtggttacagccggtgaaccattgaatccggaggtttacaacaaattctatgagttc
acaggtttaaaattgagagaaggcttcggacagactgaaaccgttgcatctgttgctaac
ttcccatggatcaaacctaaacctggatcaatgggaaaaccatctccaggatatgatgtt
atgcttcttgacaaagagggaaaaccctgtgatgttggagaagaaggggagatatgtttc
agaatccataaaaggccaataggacttttcacaggttactaccgcaaacctgagaaaacg
agggaagcatgccacggaggttactaccacacaggagacacggcctggaaggatgaagat
ggctacctctggtttgtgggacgtaacgatgacataatcaaaagttcaggctacaggata
gggcctttcgaagttgagagcgccgtaatatcccatccttcagttcttgaatgtgcaata
acgggtgtaccccaccccataagggggcaggtgataaaggcaaccatagtacttgccaag
ggttataaaccttcagaagaacttaaaaaggatatacaaaaccatgttaaaggtgtaaca
gctccttataagtatccacgtgttgttgaatttgttgaagagcttccaaaaaccataagt
ggtaaaataaaacgtgtggaaataagggaaaaagatttgggaaatgtatctggtggttca
gaaacctag

DBGET integrated database retrieval system