KEGG   Methanobacterium sp. SWAN-1: MSWAN_0223Help
Entry
MSWAN_0223        CDS       T01509                                 

Definition
Succinyl-CoA ligase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0223
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSWAN_0223
   00640 Propanoate metabolism
    MSWAN_0223
   00660 C5-Branched dibasic acid metabolism
    MSWAN_0223
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MSWAN_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
253299..254405
Genome map
AA seq 368 aa AA seqDB search
MKIHEHVAKEIFGWEGISVPQSQIAETSQEVQEVAEKLGKPVVLKSQVLAGGRGKAGGIK
FADNPSMAYKIAEELFGSELKGEIVDKLLVEEKLDIKSEFYVSVVMDRSAKKPLIMASLE
GGMDIEQIANNTPDKIVRYYLNPLDEFLPYQAREVARKMRVPNNLISKVGSVIWKLFNVF
KKYDATIAEINPLVLTDNGVMAADAKLEVDDDAIYRQKKLAKLENVQKDEFAYVKLPGDI
AVIGNGAGLTLSGMDMLKLYGGEPATFLDIGGGSSQENISKAIKLVISNENVKVVFLNVL
GGITRADDVARGVLDVLNVSQRNVPIVIRLTGTNEDEGQRILAEAGLSFETSMEEAAQKA
VKICKSLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattcatgaacacgtagcaaaggaaatatttggatgggaaggaatatcagtacca
caaagtcagattgcagaaacttcccaagaagtacaggaagtagcagagaaactgggtaaa
cccgttgtactgaaatctcaagttcttgcaggtggaagaggcaaagcaggaggcataaaa
tttgcagataatccttctatggcttataaaatagcagaagaactttttggatctgaatta
aagggggagattgttgataaattgttggtcgaggaaaaacttgacataaaatcagagttt
tatgtgagtgttgtgatggacagatcagctaaaaaacctttaataatggcaagtttagaa
ggtggtatggatatagaacagatagccaataacacccctgataaaattgttagatattat
ttgaatccccttgatgagtttctgccttaccaggcaagggaagttgccagaaaaatgaga
gttccaaataatctaatttcaaaggttggatccgtaatctggaagttattcaatgttttc
aagaaatacgatgccacaatagcagagataaaccctctggtactcactgataacggggtc
atggcggctgatgcaaagctcgaagttgatgatgatgcaatttacagacaaaaaaagctt
gcaaaactagaaaatgtccagaaagatgagtttgcatatgtgaaacttccaggtgacata
gctgtgattggaaacggtgcaggcctcacattgagtggaatggacatgctaaaactttac
ggtggagaaccagccactttccttgatataggtggtggatcatctcaggagaacatttca
aaggcaattaaacttgtaatatctaatgaaaacgttaaagttgtctttttgaatgtttta
ggcggaataacgagggcagatgatgttgcacgtggtgttttagacgtcttaaatgtttct
caacgtaatgtaccaattgttataagacttactggtaccaatgaagatgaaggacagagg
attctggctgaagcaggactttcatttgagacttctatggaggaagctgcacaaaaggct
gttaaaatctgcaagtcattgagttaa

DBGET integrated database retrieval system