KEGG   Methanobacterium sp. SWAN-1: MSWAN_0223Help
Entry
MSWAN_0223        CDS       T01509                                 

Definition
(RefSeq) Succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0223
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSWAN_0223
   00640 Propanoate metabolism
    MSWAN_0223
   00660 C5-Branched dibasic acid metabolism
    MSWAN_0223
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_0223
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MSWAN_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
253299..254405
Genome map
AA seq 368 aa AA seqDB search
MKIHEHVAKEIFGWEGISVPQSQIAETSQEVQEVAEKLGKPVVLKSQVLAGGRGKAGGIK
FADNPSMAYKIAEELFGSELKGEIVDKLLVEEKLDIKSEFYVSVVMDRSAKKPLIMASLE
GGMDIEQIANNTPDKIVRYYLNPLDEFLPYQAREVARKMRVPNNLISKVGSVIWKLFNVF
KKYDATIAEINPLVLTDNGVMAADAKLEVDDDAIYRQKKLAKLENVQKDEFAYVKLPGDI
AVIGNGAGLTLSGMDMLKLYGGEPATFLDIGGGSSQENISKAIKLVISNENVKVVFLNVL
GGITRADDVARGVLDVLNVSQRNVPIVIRLTGTNEDEGQRILAEAGLSFETSMEEAAQKA
VKICKSLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattcatgaacacgtagcaaaggaaatatttggatgggaaggaatatcagtacca
caaagtcagattgcagaaacttcccaagaagtacaggaagtagcagagaaactgggtaaa
cccgttgtactgaaatctcaagttcttgcaggtggaagaggcaaagcaggaggcataaaa
tttgcagataatccttctatggcttataaaatagcagaagaactttttggatctgaatta
aagggggagattgttgataaattgttggtcgaggaaaaacttgacataaaatcagagttt
tatgtgagtgttgtgatggacagatcagctaaaaaacctttaataatggcaagtttagaa
ggtggtatggatatagaacagatagccaataacacccctgataaaattgttagatattat
ttgaatccccttgatgagtttctgccttaccaggcaagggaagttgccagaaaaatgaga
gttccaaataatctaatttcaaaggttggatccgtaatctggaagttattcaatgttttc
aagaaatacgatgccacaatagcagagataaaccctctggtactcactgataacggggtc
atggcggctgatgcaaagctcgaagttgatgatgatgcaatttacagacaaaaaaagctt
gcaaaactagaaaatgtccagaaagatgagtttgcatatgtgaaacttccaggtgacata
gctgtgattggaaacggtgcaggcctcacattgagtggaatggacatgctaaaactttac
ggtggagaaccagccactttccttgatataggtggtggatcatctcaggagaacatttca
aaggcaattaaacttgtaatatctaatgaaaacgttaaagttgtctttttgaatgtttta
ggcggaataacgagggcagatgatgttgcacgtggtgttttagacgtcttaaatgtttct
caacgtaatgtaccaattgttataagacttactggtaccaatgaagatgaaggacagagg
attctggctgaagcaggactttcatttgagacttctatggaggaagctgcacaaaaggct
gttaaaatctgcaagtcattgagttaa

DBGET integrated database retrieval system