KEGG   Methanobacterium sp. SWAN-1: MSWAN_0227Help
Entry
MSWAN_0227        CDS       T01509                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0227
   01230 Biosynthesis of amino acids
    MSWAN_0227
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_0227
   00051 Fructose and mannose metabolism
    MSWAN_0227
   00562 Inositol phosphate metabolism
    MSWAN_0227
Enzymes [BR:mew01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSWAN_0227
Exosome [BR:mew04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSWAN_0227
  Exosomal proteins of bladder cancer cells
   MSWAN_0227
  Exosomal proteins of melanoma cells
   MSWAN_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
258674..259354
Genome map
AA seq 226 aa AA seqDB search
MKQITRTPIVILNFKTYLESTGEKALKLAKISEEVANETGMNIAVAPQHADVWRIAGEVN
IPVLAQHIDPVDAGGHTGSVLIESVKEAGASGALINHSEQRIKLADIDVVVKKAKNAGMM
SVVCTNNVETSAAAATLKPDFVAIEPPELIGSGIPVSKAEPEVVEGTVDVIHKIDPDVKV
LCGAGISTGEDMKAALGLGAEGVLLASGIILADDPKKALLDLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattaccagaactccaattgtaattctgaattttaaaacctatcttgaatcc
acaggggaaaaagccctaaaacttgcaaagatctcagaggaagttgcaaatgaaacagga
atgaacatagccgttgcaccgcagcatgctgacgtctggagaattgccggggaagttaac
atacctgtacttgctcagcacatagatcctgtggatgcagggggccacacaggtagtgtg
cttattgaatctgtaaaagaagcaggagcatcaggtgccctgataaatcattcagagcaa
agaattaaacttgctgatatagatgtcgttgtgaaaaaagctaaaaatgcaggtatgatg
agtgttgtctgcacaaacaacgttgagacaagtgcggctgcagcaacattgaaaccagat
tttgtagcgatagaaccaccagaactcataggatcaggcataccagtttcaaaggcagaa
cctgaagtagttgaaggaacagttgatgtgatacacaaaatagaccccgatgtgaaggtt
ctctgcggtgctggtatctccacaggtgaagacatgaaagctgcacttggccttggtgca
gaaggtgtcctgcttgcatctggaataatacttgcagatgatcctaaaaaagcactcctt
gaccttgtaagtaagatataa

DBGET integrated database retrieval system