KEGG   Methanobacterium sp. SWAN-1: MSWAN_0227Help
Entry
MSWAN_0227        CDS       T01509                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_0227
   01230 Biosynthesis of amino acids
    MSWAN_0227
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_0227
   00051 Fructose and mannose metabolism
    MSWAN_0227
   00562 Inositol phosphate metabolism
    MSWAN_0227
Enzymes [BR:mew01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSWAN_0227
Exosome [BR:mew04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSWAN_0227
  Exosomal proteins of bladder cancer cells
   MSWAN_0227
  Exosomal proteins of melanoma cells
   MSWAN_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
258674..259354
Genome map
AA seq 226 aa AA seqDB search
MKQITRTPIVILNFKTYLESTGEKALKLAKISEEVANETGMNIAVAPQHADVWRIAGEVN
IPVLAQHIDPVDAGGHTGSVLIESVKEAGASGALINHSEQRIKLADIDVVVKKAKNAGMM
SVVCTNNVETSAAAATLKPDFVAIEPPELIGSGIPVSKAEPEVVEGTVDVIHKIDPDVKV
LCGAGISTGEDMKAALGLGAEGVLLASGIILADDPKKALLDLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattaccagaactccaattgtaattctgaattttaaaacctatcttgaatcc
acaggggaaaaagccctaaaacttgcaaagatctcagaggaagttgcaaatgaaacagga
atgaacatagccgttgcaccgcagcatgctgacgtctggagaattgccggggaagttaac
atacctgtacttgctcagcacatagatcctgtggatgcagggggccacacaggtagtgtg
cttattgaatctgtaaaagaagcaggagcatcaggtgccctgataaatcattcagagcaa
agaattaaacttgctgatatagatgtcgttgtgaaaaaagctaaaaatgcaggtatgatg
agtgttgtctgcacaaacaacgttgagacaagtgcggctgcagcaacattgaaaccagat
tttgtagcgatagaaccaccagaactcataggatcaggcataccagtttcaaaggcagaa
cctgaagtagttgaaggaacagttgatgtgatacacaaaatagaccccgatgtgaaggtt
ctctgcggtgctggtatctccacaggtgaagacatgaaagctgcacttggccttggtgca
gaaggtgtcctgcttgcatctggaataatacttgcagatgatcctaaaaaagcactcctt
gaccttgtaagtaagatataa

DBGET integrated database retrieval system