KEGG   Methanobacterium sp. SWAN-1: MSWAN_0227Help
Entry
MSWAN_0227        CDS       T01509                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mew01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mew01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mew00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mew00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mew00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
258674..259354
Genome map
AA seq 226 aa AA seqDB search
MKQITRTPIVILNFKTYLESTGEKALKLAKISEEVANETGMNIAVAPQHADVWRIAGEVN
IPVLAQHIDPVDAGGHTGSVLIESVKEAGASGALINHSEQRIKLADIDVVVKKAKNAGMM
SVVCTNNVETSAAAATLKPDFVAIEPPELIGSGIPVSKAEPEVVEGTVDVIHKIDPDVKV
LCGAGISTGEDMKAALGLGAEGVLLASGIILADDPKKALLDLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattaccagaactccaattgtaattctgaattttaaaacctatcttgaatcc
acaggggaaaaagccctaaaacttgcaaagatctcagaggaagttgcaaatgaaacagga
atgaacatagccgttgcaccgcagcatgctgacgtctggagaattgccggggaagttaac
atacctgtacttgctcagcacatagatcctgtggatgcagggggccacacaggtagtgtg
cttattgaatctgtaaaagaagcaggagcatcaggtgccctgataaatcattcagagcaa
agaattaaacttgctgatatagatgtcgttgtgaaaaaagctaaaaatgcaggtatgatg
agtgttgtctgcacaaacaacgttgagacaagtgcggctgcagcaacattgaaaccagat
tttgtagcgatagaaccaccagaactcataggatcaggcataccagtttcaaaggcagaa
cctgaagtagttgaaggaacagttgatgtgatacacaaaatagaccccgatgtgaaggtt
ctctgcggtgctggtatctccacaggtgaagacatgaaagctgcacttggccttggtgca
gaaggtgtcctgcttgcatctggaataatacttgcagatgatcctaaaaaagcactcctt
gaccttgtaagtaagatataa

DBGET integrated database retrieval system