KEGG   Methanobacterium sp. SWAN-1: MSWAN_0430Help
Entry
MSWAN_0430        CDS       T01509                                 

Definition
Mur ligase middle domain-containing protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Lysine biosynthesis
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MSWAN_0430
Enzymes [BR:mew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MSWAN_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(476233..477666)
Genome map
AA seq 477 aa AA seqDB search
MDIIKTSYLADKVNGKLIGPDKEISGIFNFLNTSKRGDAVIRHWIDEKGVEIAVSKGVSC
IITQNPQGNAIETAKKLKFPLIITEKIELANAFAISWAVENFATDSIRIVVTGTNGKSTT
THMIYSILKEAGYNTYTNTDSKSEFNTLIDPIVSKQIAEFPDKIEAMVVEVSEVQGWLGK
LMKNHASLMTSAIDPNVVVLTNVALDHIGLVNSVEEAFDEISGSIKALKKPKKTIAVLNH
DDPLIRKMENFKGNDTEVIFYGEGAAVESKAEGIFYEGKLLIKKEDLPFKSQHFIQNTMA
AIEASLSLNVDLKYIKSAVTSYKPLKRRFNILSQNPLIIDDFAHNPNGIVVTINSAAKIT
KGKLCLVTAIRGSRGDPINLANAEAIVKGLKGLEKGTNFNLIITTSTDFVDKANVVKNSE
KDVFLNTLEKEGLSYIFHETLHNALKAALKSAGKEDTILLIGAQGMDPASDVLRSID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggacatcattaaaacatcttatctggcagataaagtaaatggaaaacttatcggacca
gataaagaaatttctggcattttcaattttcttaatacttcaaaaagaggagatgctgta
ataaggcactggatagatgagaaaggtgttgaaatcgcagtctccaagggcgtttcatgt
ataataacccaaaatccgcaaggaaatgccattgaaactgcaaaaaagttaaaattccca
ctcataatcacagaaaagatagaacttgccaatgccttcgcaattagttgggcagttgag
aactttgcaacagattccattcgaattgttgtaacaggtacaaatggtaaatcaacaact
acccatatgatttacagtatccttaaggaagctggttacaacacatacacaaacactgat
tcaaaatctgaattcaacacattgattgatcccatcgtttcaaagcagattgcagagttt
ccagacaaaattgaagccatggtcgtggaggtttcagaggtccaaggctggcttggtaag
ttaatgaaaaaccacgccagtttaatgacctctgcaattgacccaaacgtggtcgtactt
acaaacgttgcactggatcatataggtcttgtaaattcagttgaagaggcctttgatgaa
atatcaggttcaattaaagcattgaaaaaacccaaaaagaccattgccgtcttaaatcat
gatgatcctctaatacgaaagatggaaaatttcaaaggcaatgatactgaagttattttt
tatggggaaggcgcagccgtagaatccaaggcggaagggatattttatgaaggcaaactt
ctcattaaaaaagaggatctgcccttcaagagtcaacacttcatccagaatacaatggca
gcaatagaagcatctctatcattaaatgtagatttaaaatacataaaaagtgctgtaact
tcatataaacctttgaaaagaaggttcaacatcttaagtcaaaatccgctcataattgat
gattttgcccacaaccccaatggaatagttgtaaccataaacagtgcagccaaaataact
aaaggaaagttatgcctcgtaactgcaataaggggttcaagaggtgacccaataaacctt
gcaaatgcagaagcaattgttaaaggtcttaagggtcttgaaaagggaactaatttcaat
ttaataataaccacgagcactgactttgttgacaaagcaaacgttgtgaaaaactctgaa
aaagatgtatttctaaatacgcttgaaaaagaaggcttaagttatattttccatgaaaca
ttacacaatgcattaaaagctgccctcaaatctgcaggaaaagaggatactatcctatta
attggggcacaaggaatggatcctgcatcagatgttcttagatcaattgattaa

DBGET integrated database retrieval system