KEGG   Methanobacterium sp. SWAN-1: MSWAN_0430Help
Entry
MSWAN_0430        CDS       T01509                                 

Definition
Mur ligase middle domain-containing protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Lysine biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mew00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(476233..477666)
Genome map
AA seq 477 aa AA seqDB search
MDIIKTSYLADKVNGKLIGPDKEISGIFNFLNTSKRGDAVIRHWIDEKGVEIAVSKGVSC
IITQNPQGNAIETAKKLKFPLIITEKIELANAFAISWAVENFATDSIRIVVTGTNGKSTT
THMIYSILKEAGYNTYTNTDSKSEFNTLIDPIVSKQIAEFPDKIEAMVVEVSEVQGWLGK
LMKNHASLMTSAIDPNVVVLTNVALDHIGLVNSVEEAFDEISGSIKALKKPKKTIAVLNH
DDPLIRKMENFKGNDTEVIFYGEGAAVESKAEGIFYEGKLLIKKEDLPFKSQHFIQNTMA
AIEASLSLNVDLKYIKSAVTSYKPLKRRFNILSQNPLIIDDFAHNPNGIVVTINSAAKIT
KGKLCLVTAIRGSRGDPINLANAEAIVKGLKGLEKGTNFNLIITTSTDFVDKANVVKNSE
KDVFLNTLEKEGLSYIFHETLHNALKAALKSAGKEDTILLIGAQGMDPASDVLRSID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggacatcattaaaacatcttatctggcagataaagtaaatggaaaacttatcggacca
gataaagaaatttctggcattttcaattttcttaatacttcaaaaagaggagatgctgta
ataaggcactggatagatgagaaaggtgttgaaatcgcagtctccaagggcgtttcatgt
ataataacccaaaatccgcaaggaaatgccattgaaactgcaaaaaagttaaaattccca
ctcataatcacagaaaagatagaacttgccaatgccttcgcaattagttgggcagttgag
aactttgcaacagattccattcgaattgttgtaacaggtacaaatggtaaatcaacaact
acccatatgatttacagtatccttaaggaagctggttacaacacatacacaaacactgat
tcaaaatctgaattcaacacattgattgatcccatcgtttcaaagcagattgcagagttt
ccagacaaaattgaagccatggtcgtggaggtttcagaggtccaaggctggcttggtaag
ttaatgaaaaaccacgccagtttaatgacctctgcaattgacccaaacgtggtcgtactt
acaaacgttgcactggatcatataggtcttgtaaattcagttgaagaggcctttgatgaa
atatcaggttcaattaaagcattgaaaaaacccaaaaagaccattgccgtcttaaatcat
gatgatcctctaatacgaaagatggaaaatttcaaaggcaatgatactgaagttattttt
tatggggaaggcgcagccgtagaatccaaggcggaagggatattttatgaaggcaaactt
ctcattaaaaaagaggatctgcccttcaagagtcaacacttcatccagaatacaatggca
gcaatagaagcatctctatcattaaatgtagatttaaaatacataaaaagtgctgtaact
tcatataaacctttgaaaagaaggttcaacatcttaagtcaaaatccgctcataattgat
gattttgcccacaaccccaatggaatagttgtaaccataaacagtgcagccaaaataact
aaaggaaagttatgcctcgtaactgcaataaggggttcaagaggtgacccaataaacctt
gcaaatgcagaagcaattgttaaaggtcttaagggtcttgaaaagggaactaatttcaat
ttaataataaccacgagcactgactttgttgacaaagcaaacgttgtgaaaaactctgaa
aaagatgtatttctaaatacgcttgaaaaagaaggcttaagttatattttccatgaaaca
ttacacaatgcattaaaagctgccctcaaatctgcaggaaaagaggatactatcctatta
attggggcacaaggaatggatcctgcatcagatgttcttagatcaattgattaa

DBGET integrated database retrieval system