KEGG   Methanobacterium sp. SWAN-1: MSWAN_0493Help
Entry
MSWAN_0493        CDS       T01509                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mew00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(534410..535210)
Genome map
AA seq 266 aa AA seqDB search
MNDNLNIKGKVIAITRPAERSQKAADIVEKYGGIPLVAPTLELQVSNSKSLINLCKIADK
LDWMIFTSPTGILSIIKHCKDLKERLNPNCKIAVIGPRTGKYLNEQGLDADIIPEDYTAE
GLLEIFKDINVRNKKIGIPRTMAARDVLPEGLKAMGAEVLLAEAYKSAVPKDKGKVKKLI
NSVISKDVDAVTFTSTLTVKNLFEVAEKEEKKEELIESLQNNVLVAAIGPVTAKPLEEEN
INAITPDEYTVKAMLEKLFGEMNSKI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaatcttaacatcaaaggtaaagtaatagccataaccagaccagctgaacga
agtcaaaaggctgcggacatcgttgaaaagtacggtggaatacctctggtggcaccaacc
cttgaacttcaagtttccaactccaaatcactgatcaatctctgtaaaatagcagataaa
cttgactggatgatattcacctccccaacaggaattttatccataattaaacattgcaaa
gatctaaaagaaagactaaaccccaactgtaaaatagcagttatcggccccagaacagga
aaatatctaaatgaacaggggctggacgccgacatcattcctgaagattacactgcagag
ggacttcttgaaatttttaaggatataaatgttcgtaataaaaaaataggaattccaaga
accatggcagcaagagatgtgctccccgaaggcctaaaagctatgggtgcagaggtttta
ctggctgaagcatataaatcagctgttccaaaggataaagggaaagttaaaaagcttata
aatagtgtaatcagcaaagatgtggatgctgtaaccttcacaagtactttaaccgttaaa
aatctgtttgaagtagcagaaaaagaagagaaaaaagaggaattgattgaatccctacaa
aataacgttttagttgctgcaatcggccctgtaacagctaaaccccttgaagaggaaaat
atcaatgcaataactccagatgaatacacggttaaagcaatgcttgagaaattgtttgga
gaaatgaacagtaaaatctga

DBGET integrated database retrieval system