KEGG   Methanobacterium paludis: MSWAN_0493Help
Entry
MSWAN_0493        CDS       T01509                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mew  Methanobacterium paludis
Pathway
mew00860  Porphyrin and chlorophyll metabolism
mew01100  Metabolic pathways
mew01110  Biosynthesis of secondary metabolites
mew01120  Microbial metabolism in diverse environments
Module
mew_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSWAN_0493
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MSWAN_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 XPG_I Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: AEG17532
JGI: MSWAN_0493
UniProt: F6D4P7
Position
complement(534410..535210)
Genome map
AA seq 266 aa AA seqDB search
MNDNLNIKGKVIAITRPAERSQKAADIVEKYGGIPLVAPTLELQVSNSKSLINLCKIADK
LDWMIFTSPTGILSIIKHCKDLKERLNPNCKIAVIGPRTGKYLNEQGLDADIIPEDYTAE
GLLEIFKDINVRNKKIGIPRTMAARDVLPEGLKAMGAEVLLAEAYKSAVPKDKGKVKKLI
NSVISKDVDAVTFTSTLTVKNLFEVAEKEEKKEELIESLQNNVLVAAIGPVTAKPLEEEN
INAITPDEYTVKAMLEKLFGEMNSKI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaatcttaacatcaaaggtaaagtaatagccataaccagaccagctgaacga
agtcaaaaggctgcggacatcgttgaaaagtacggtggaatacctctggtggcaccaacc
cttgaacttcaagtttccaactccaaatcactgatcaatctctgtaaaatagcagataaa
cttgactggatgatattcacctccccaacaggaattttatccataattaaacattgcaaa
gatctaaaagaaagactaaaccccaactgtaaaatagcagttatcggccccagaacagga
aaatatctaaatgaacaggggctggacgccgacatcattcctgaagattacactgcagag
ggacttcttgaaatttttaaggatataaatgttcgtaataaaaaaataggaattccaaga
accatggcagcaagagatgtgctccccgaaggcctaaaagctatgggtgcagaggtttta
ctggctgaagcatataaatcagctgttccaaaggataaagggaaagttaaaaagcttata
aatagtgtaatcagcaaagatgtggatgctgtaaccttcacaagtactttaaccgttaaa
aatctgtttgaagtagcagaaaaagaagagaaaaaagaggaattgattgaatccctacaa
aataacgttttagttgctgcaatcggccctgtaacagctaaaccccttgaagaggaaaat
atcaatgcaataactccagatgaatacacggttaaagcaatgcttgagaaattgtttgga
gaaatgaacagtaaaatctga

DBGET integrated database retrieval system