KEGG   Methanobacterium paludis: MSWAN_0594Help
Entry
MSWAN_0594        CDS       T01509                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mew  Methanobacterium paludis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSWAN_0594
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSWAN_0594
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSWAN_0594
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSWAN_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
643236..644417
Genome map
AA seq 393 aa AA seqDB search
MITKGKFGKYGGVFVPELIIPALEELEKAFLKYKDDKKFNEELEFYLREFAGRPTGLYYA
SNLSKKLGCKIYLKREDMLHTGAHKINNTLGQGLLAKYMGKTRLIAETGAGQHGIATAVV
GAMLGIPVEVYMGSEDVERQKLNVFRMELSGAGVTPVESGSCTLKDAINEAFRDWITNVE
TTHYLIGSTMGPHPYPTMVKHFQSVIGREAKKQILEKEGKLPDVVIACVGGGSNSMGIFS
EFIDHEEVDLIGVEGGGDGVETENTGATLCKGTEGVLHGSLSFVLQNDDGQINEASSISA
GLDYPGVGPEHAYLKVTGRAKYVAVTDKEALEGFELLSKYEGIIPALESSHAVAYAIKYA
KMEENKGKTIVVNLSGRGDKDMFIVAKEMGEKI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgataacaaaaggtaaatttggtaaatatgggggagtttttgttcctgaactcatcata
cctgcgcttgaagaacttgaaaaggcttttttgaagtacaaagatgataaaaagttcaat
gaggaactggaattttacctgcgtgagtttgcaggaaggccaacaggcctttactacgcc
agcaacttatcaaaaaaacttggatgcaaaatttacctcaaaagagaggatatgctgcac
acaggagctcataaaataaacaacactcttggacagggactccttgccaagtacatggga
aaaacgaggttaattgctgaaactggggcagggcagcatggaattgcaactgcagttgtt
ggggcaatgcttggaataccagttgaggtttacatgggaagtgaggacgtggaaaggcag
aaattgaacgttttcaggatggaactttcaggtgccggcgtaacacccgttgaatcagga
tcctgcacccttaaagatgcgataaacgaggcgttcagggactggatcaccaacgttgaa
accacccattacctcataggctcgacaatgggaccccatccttacccaacaatggttaaa
catttccagagtgttataggacgtgaagcaaagaaacagatcttagaaaaagaaggtaaa
cttccagatgtggttatagcatgtgttggagggggaagcaactccatgggaatattttca
gagttcatagaccacgaagaggtggatctgataggtgttgaaggtggtggagatggagtg
gaaactgaaaatacaggagcaaccctttgtaaaggtactgagggagtacttcatggttca
ctttcatttgtacttcaaaacgatgatggccagatcaacgaggctagttcaatttcagca
ggtctggactaccctggagttggacctgaacacgcctacctcaaggtcacaggacgtgca
aaatatgttgcagtaacagacaaagaggcactagaaggatttgaactgttatcaaaatac
gaaggaataatacctgcccttgaaagttcccatgcagttgcatatgctataaaatatgct
aaaatggaagagaacaagggaaaaaccatagttgtgaacctttcaggaagaggggacaag
gacatgtttatagttgccaaagaaatgggtgagaagatatga

DBGET integrated database retrieval system