KEGG   Methanobacterium paludis: MSWAN_0595Help
Entry
MSWAN_0595        CDS       T01509                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mew  Methanobacterium paludis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSWAN_0595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSWAN_0595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSWAN_0595
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSWAN_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
644414..645256
Genome map
AA seq 280 aa AA seqDB search
MNPNNNTQNNKIKVDSYLEMFKKVKDKGEGAFIPFVVAGDPDFETSLQIVKKLVESGADS
LEIGFTFSDPVADGPTVQNADIRASNTGMTTKKGFEFIKRVREFTGIPIGLLVYYNLIYK
MGIDEFYKNASEVGVNGVLAADLPPEEAQDAVKTARKYGVDPIFIAAQTTSNERLKQIAD
MCSGFLYVVSVMGVTGARSEVKTSTVELVERMRSHTDIPICVGFGISKPEHVTEVIEAGA
DGAIVGSALINVIAENLDDYESIKTKIGNSCSNLKEATRN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaataacaacactcaaaataataaaatcaaggtagactcctatttggaaatg
ttcaaaaaagttaaagataaaggtgaaggggcattcataccatttgttgttgcaggagac
cctgattttgaaacatcactccagatcgtgaaaaaactggttgaaagtggagcagacagt
cttgaaataggatttacattcagtgatcctgttgcagacggcccaaccgtgcaaaatgca
gatataagggcatccaatacaggcatgaccacaaaaaaaggatttgaatttataaaaaga
gtccgtgaatttacaggcattccgataggacttctggtatattacaacctcatctacaag
atgggaatcgatgagttttataaaaatgcaagtgaagtcggtgtaaacggtgtacttgca
gcagatctgccacctgaagaagcacaggatgcagtaaaaacagcccgaaagtatggggtg
gatccgatattcattgccgcacaaaccaccagcaatgaaaggcttaaacagattgcagac
atgtgttcaggatttctttacgtggtatcagtcatgggagtcacaggtgcaaggtctgaa
gttaaaaccagcactgttgaactggttgaaagaatgcgcagccacacagatattcccata
tgtgtaggttttggaatttcaaagccggagcatgtaactgaggttattgaagcaggggct
gatggtgcaatcgtgggaagcgcactcataaatgttattgcagaaaatcttgatgattac
gagagcataaaaacaaaaataggaaattcctgcagtaatttgaaggaagcaacccgaaat
taa

DBGET integrated database retrieval system