KEGG   Methanobacterium paludis: MSWAN_0678Help
Entry
MSWAN_0678        CDS       T01509                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mew  Methanobacterium paludis
Brite
Enzymes [BR:mew01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MSWAN_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT GCD14 Methyltransf_31 RrnaAD CMAS Methyltransf_3 Methyltransf_25 Fibrillarin Methyltransf_23 Methyltransf_24 MTS Ubie_methyltran Methyltransf_11 Methyltr_RsmB-F Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: AEG17713
JGI: MSWAN_0678
UniProt: F6D6K0
Position
734254..734907
Genome map
AA seq 217 aa AA seqDB search
MKKDRKDLVERLSDQGYIKTDRVRKAMLEVPREEFLPPESRPYAYIDQPLPIGHGQTISA
PHMVAIICEQLELTEGMKVLEIGTGYGYNAAVVAECIGPEGHLYTIERVGSLAEKAKDNL
KKTGSDNVTVIIGDGTLGYPDKVPYDRIYGTASAPKVPETLKKQLKIGGRLLIPVGLDDF
FQELVCVVRVAEEEYKSQKLGGVRFVPMIGEHGWSER
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagataggaaagatctcgtagagagactctcagatcagggttacataaaaaca
gatagagtcaggaaggctatgttagaagttccgagagaggaatttttacctcctgaaagc
aggccctatgcttacatagaccagcctttacccataggacatggtcagaccatatctgca
cctcatatggtggcaataatatgcgaacaacttgaacttaccgaaggcatgaaggtttta
gaaataggaacaggttatggatacaatgcagctgttgttgcagaatgtataggtcctgaa
gggcatttatacaccattgaacgggtaggatcccttgctgaaaaagcaaaggataacctt
aaaaaaacaggttctgataatgttacagttataataggcgatggaacgttaggatatcct
gataaagttccatacgataggatttatggtacagcaagcgcccccaaggtacctgaaacc
ctgaaaaaacagcttaaaattggtggaagacttttaataccagttggtttggatgatttt
tttcaggagcttgtgtgtgttgtgagggtagcggaagaggaatataaatctcaaaagctc
ggtggggtaaggtttgtgccaatgatcggtgaacatggatggtctgaaaggtga

DBGET integrated database retrieval system