KEGG   Methanobacterium paludis: MSWAN_0691Help
Entry
MSWAN_0691        CDS       T01509                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family (EC:2.3.1.48)
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mew  Methanobacterium paludis
Brite
Enzymes [BR:mew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MSWAN_0691
Transfer RNA biogenesis [BR:mew03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MSWAN_0691
Chromosome [BR:mew03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MSWAN_0691
   HAT complexes
    Elongator complex
     MSWAN_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(745579..747210)
Genome map
AA seq 543 aa AA seqDB search
MEEACRLIINEILEGNIKTKSDLEKAKLKACREFQLEKFMSNSMILRTATLEERRMIAPV
VQKKPTRTISGVAVVAVMCKPHKCPHGRCLYCPESKNAPPSYTGEEPAALRARMFDFHPY
KQTYNRLLQLESIGHPLDKVELIVMGGTFPSYFLCYQEWFISKCLEAMNDFGIKNPEESI
KIKSDTHMDVPQDFVYLEDVQRTNEKSPVRCVGMTFETRPDYCKIPDVDRMLNMGVTRVE
LGVQTIYNFIYKRIERGHTIEDVVESTRILRDSGIKVAMHLMPGLFSDFDRDMRIFKRVF
SDSRFKPDMLKIYPCLVTEGSKIHEMWQKGEYIPYTTEEAVDLIVEVKKILPKWVRTMRI
QRDIPSPLIEAGVKKSNLGELVYNKLTEHGANCKCIRCREVGHRAAEGVNTNFDDIKLLR
EEYDAGEGREIFLSFEDVKSDVLIGFLRLRMPSAKAHRKEVDSKTALLRELHVYGPMAKI
GDKKQAEIWQHMGYGEQLLAEAEKIASEEYDKNKLLVISGIGARNYYKKFGYSREGPYMS
KRI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggcttgcagactcataatcaacgaaatccttgaaggaaatattaaaacaaaa
agtgaccttgaaaaggccaagctcaaagcctgtagagagttccagcttgagaagttcatg
agcaattccatgatacttcggactgccactctagaagaaaggcgaatgatagcaccggtt
gtacagaagaaaccaacaagaacaatctcaggggttgctgtggttgctgtgatgtgcaaa
ccccataaatgtccccatggaagatgtttatactgccctgaaagcaagaatgcacctcca
agttatacaggagaagagccggcggcacttcgggcccgtatgttcgatttccatccgtac
aaacaaacctacaaccgtcttttacaacttgaaagtataggccacccactggacaaggtt
gaactcatagtgatgggaggaacattcccatcgtacttcctctgttaccaggaatggttt
ataagtaaatgtctggaagcgatgaacgattttgggataaaaaatcctgaagaaagtatt
aaaatcaaatcagacacccacatggatgttccacaggattttgtttaccttgaggatgtt
caaagaaccaatgaaaagtcccctgtacgctgcgttggaatgacctttgaaaccagacca
gattactgtaaaattcctgatgttgaccgtatgcttaacatgggtgttacaagagtggag
ttaggtgttcaaaccatttacaacttcatatacaaacgtatagaacgcgggcacaccatc
gaggatgtggttgaatctacaaggatactcagggattcgggtatcaaagttgcaatgcac
ctcatgcccggactattttcagattttgatagggatatgaggatattcaaaagagtgttc
agtgattccagattcaaacccgacatgctgaagatatacccctgccttgtgactgaaggc
tctaagatccatgaaatgtggcagaagggtgagtacattccttacacaactgaggaagct
gtggacctcatagttgaagtcaagaagatcctgcccaaatgggttcggaccatgaggatt
caaagggacataccatcacccctcatagaagcgggtgttaaaaaatccaacctcggtgag
ctcgtttacaataaactcacagaacatggagctaactgcaagtgtataagatgcagagaa
gttgggcatagggccgcggagggtgtgaacaccaattttgatgatataaaactccttcgt
gaagaatacgatgcaggcgaaggacgagagatatttctttcatttgaagatgtgaaatca
gacgttctcatcggatttttaaggctgagaatgccgtcagcgaaggcccacagaaaagaa
gttgacagtaaaacagccctcttgagggaactgcacgtttacgggccaatggccaagata
ggagataaaaaacaggccgaaatatggcagcacatgggctacggtgagcagcttctagct
gaagccgagaaaatagcttccgaagaatatgataagaacaaattgcttgtgataagtggt
attggggctcgaaattactataaaaaatttggatacagcagagagggtccctacatgtca
aagaggatttaa

DBGET integrated database retrieval system