KEGG   Methanobacterium paludis: MSWAN_0959Help
Entry
MSWAN_0959        CDS       T01509                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mew  Methanobacterium paludis
Pathway
mew00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSWAN_0959
Enzymes [BR:mew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MSWAN_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AEG17983
JGI: MSWAN_0959
UniProt: F6D2P9
Position
1045290..1046249
Genome map
AA seq 319 aa AA seqDB search
MSFDVVGFGALNVDKLYNVNKIAHEDEESYITGLSESCGGSAANTIVGLSRLGLNTGFIG
KVASDREGTLLLKNLEDENVDTDGVILESDGRSGVVSGFVDRDGQRALYVDPGVNDLIEQ
DEVQTGYVTGSKVLHMASFVGKFEDKSIKAQKTFLKRIPDDISVSIDPGRLYAERGMDFL
EKFLEKTNIILINEAELNLLTEEKYRGNYKGNKTCENGSKILLDYGIDIIAVKRGDKGVY
VTDGCRSYFMDAFKVQCVDTTGAGDAFNAGFLYGLINGENIEKSALIGNFVASKCVEECG
ATDGLPDVYGIAGLVTGFK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgatgttgtgggatttggggctctgaatgttgacaaattatacaatgtgaac
aaaatagcccatgaagatgaagagtcttacataacaggtttaagcgagtcgtgtgggggt
tctgcagcaaatacaattgtaggactttcaagattaggtttaaacacgggcttcattggt
aaagttgcatcagaccgtgaaggaactcttttacttaaaaatcttgaagatgaaaacgtt
gacacagatggtgtgattttagaatctgatggacgaagcggagttgtcagcggatttgtt
gatagagatggtcaaagggcgttgtacgttgatcccggtgtcaatgatttaattgaacag
gatgaagtccaaactggttatgttacaggttcaaaggtccttcatatggcatcatttgtt
ggaaaatttgaagataaatccataaaagcccagaaaacctttttaaaaagaattcctgat
gatatatctgtgagcattgaccccggacgtttatatgctgaaagagggatggattttctc
gaaaaatttcttgagaagacaaatattattcttataaatgaggctgagttgaatctttta
acagaggaaaaatataggggaaactataaagggaataaaacctgtgaaaatggaagtaaa
attcttttagactatggaatagatataattgcagttaaacgtggggataaaggcgtatat
gttactgacggttgccgctcctattttatggatgcattcaaagttcaatgtgtggataca
actggtgcaggtgatgcattcaatgcaggattcctttatggacttataaacggggagaac
attgaaaaatctgctttaatcggtaattttgtagcatcaaaatgtgttgaagaatgcggt
gcaacagatggtcttcctgatgtttatggaattgcaggattagttactggttttaagtaa

DBGET integrated database retrieval system