KEGG   Methanobacterium paludis: MSWAN_1055Help
Entry
MSWAN_1055        CDS       T01509                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mew  Methanobacterium paludis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1142339..1143367
Genome map
AA seq 342 aa AA seqDB search
MRKLLKKLTDAPGISGFEDGIRNVMIDEVKDHVDEIEVDNMGNMIATKKGKEGSKKVMLA
AHMDEIGLLVRYIDKNGFIKFSKIGGINDQMLLNQEVTVYASKGEIIGVIGSKPPHRMKE
SERKKILGYEDMFIDIGAADKEEAEKMVAVGDPIIINQNFAELGTSLVKAKALDNRVGCA
VLVEVMKQLESDATVYGVATVQEEVGLKGAKTSAFKLNPDMAIVLDVTISGDHPGIKEDE
APAKAGKGPVIVLADASGRGLITHPKVKELLTSVADEEKIPYQLEVSEGGTTDASVIHLT
REGIPTGVISPASRYIHTPVSVVNVEDVENAVKLIVAVLKRI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactactaaaaaaacttacagatgcgccaggaatttctggctttgaagatgga
attcgaaatgtaatgatagatgaagtaaaagaccatgtggatgaaattgaagttgacaac
atgggaaacatgatcgctaccaaaaagggaaaggaaggcagtaaaaaggtcatgttagca
gctcatatggatgaaataggacttttagttcgttatattgataaaaatgggttcataaag
ttctcaaagatcggcggaataaacgatcagatgcttttaaaccaggaagttactgtatac
gcttctaaaggtgagataataggagttataggttcaaaaccaccacacaggatgaaagaa
tctgaaagaaaaaaaatacttggttatgaggacatgttcatagatataggggctgcagat
aaggaagaagctgaaaaaatggtggcagttggcgaccccatcataataaatcagaacttt
gcagaacttggaacatctctggtcaaggcaaaggcccttgacaacagagtgggctgtgca
gtgcttgttgaagtaatgaaacagcttgaaagtgatgcaacagtttatggtgttgcaaca
gtccaggaagaagttggtcttaaaggtgcaaaaacctctgcattcaagttaaaccccgac
atggccatagtccttgatgttacaatatccggcgaccaccctggtatcaaggaagacgag
gcccctgcaaaggcaggtaaaggtccagtcatagtgcttgcagatgcaagtggaagagga
ctcataacacatcccaaagtgaaagaactccttacctctgttgcagacgaagaaaaaata
ccttaccagctcgaagtcagtgagggaggaacaaccgatgcttcagtgatacaccttaca
agggaaggaatcccaactggagttatatcacctgcatcaaggtacatacacactcctgta
agtgttgtgaacgttgaagatgttgaaaatgcagtaaaacttattgtggctgttcttaaa
aggatttaa

DBGET integrated database retrieval system