KEGG   Methanobacterium sp. SWAN-1: MSWAN_1072Help
Entry
MSWAN_1072        CDS       T01509                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mew00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1164423..1165394
Genome map
AA seq 323 aa AA seqDB search
MEFPITRMRRLRKTPQIRNILSETKLNPEDFIYPMYVKEGLADGHAEHISTMPGQYRYSI
NDAVEKARELEDIGLSSIMIFGLPLEKDEKGSQAYNKDGIVQQAVRRMKEETDLIVMTDV
CMCQYTSHGHCGMVKDDKILNDESLNYISKIALSHAEAGADVVAPSDMMDGRVGAIRKTL
DLNGYYDTIIMAYSAKYASSFYAPFREAASSAPGFGDRKTYQMDPSNLLEALREVELDIG
EGADIVMVKPAMPYLDVLKAVKDEFKMPTAAYQVSGEYSMLKAGIDAGYITEDSIYESLL
SIKRAGADLIITYFAPEFLEGKI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaatttccaattacaagaatgcgaagattaaggaaaactccccagataagaaatata
ctgagtgaaacaaagttaaatcctgaagattttatatacccaatgtacgtaaaggagggg
ctggctgacgggcatgcagaacatataagcaccatgcctggacagtacaggtattctatc
aatgatgccgtggaaaaggccagagaacttgaggatataggactatcttccataatgatc
tttggactgccacttgaaaaggatgagaaaggttctcaagcctacaacaaggatggaatt
gttcaacaggcagtgcgccgcatgaaggaagaaacagaccttattgttatgacggatgtc
tgcatgtgtcagtacacatcccatggccactgtggaatggttaaagatgataaaatcctt
aatgatgaaagcctgaattacatctcaaaaattgctttaagtcacgcagaagctggagct
gatgttgtggctccatcagatatgatggatggtagagttggtgctataaggaaaacactg
gatttgaatggttactatgacacaatcataatggcttactctgcaaaatatgcttcttca
ttttatgccccattcagggaggcagcatcttctgccccaggttttggtgacaggaaaact
tatcaaatggatccctcaaaccttctggaagccttaagggaagttgaacttgacataggg
gaaggtgctgatatagtgatggtgaaacccgccatgccttaccttgacgtcttaaaagct
gtaaaagatgaatttaaaatgcctacagcagcttaccaggtaagcggtgaatattcaatg
ttaaaagctggaatagatgcaggttacataactgaagattccatatatgaatcgttgtta
tccataaaaagggcgggtgcagaccttataatcacctactttgcacctgaatttttagag
gggaaaatttag

DBGET integrated database retrieval system