KEGG   Methanobacterium sp. SWAN-1: MSWAN_1700Help
Entry
MSWAN_1700        CDS       T01509                                 

Definition
fructokinase (EC:2.7.1.4)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSWAN_1700
Enzymes [BR:mew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MSWAN_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1795028..1795885)
Genome map
AA seq 285 aa AA seqDB search
MKKFSLDVIGLGTCNADFIMKVPRFVESDDEVDIQELLPSIGGSAANFAVGISRQGLKAG
IMTRIGKDHFGRLAVQKFRDEGVDTERLLHINEKTGMAFIAVDSHGERAMYTFMGANAKF
YLEKEDIEYIKSSKLLHITGMYKEVVEEASKHANLLSLNPGTLLSSYGLKTLDKIIKKAH
IIFLNKKEVKILTGLNFNEGSQTILNMGVPIVVVTCGKSGATVYTENDVISSPTGGVEAL
DTTGAGDAFAAGFIASFVKDKKLEDCLKMGNIVAAQCVGRLGALK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttcagtctcgatgtaattggacttggaacttgcaatgctgattttataatg
aaggttccaaggtttgtagaatcagatgatgaggttgatattcaagagcttttgccctca
attggaggatcagcggctaattttgctgtaggaatatcaagacagggtttgaaagccgga
ataatgacaagaataggtaaagaccactttggaagattggcggtccaaaaatttagggac
gagggagttgacacagaaaggcttctccatataaatgaaaaaactggaatggcatttatt
gcagttgattcacatggtgaaagagcgatgtacacattcatgggtgcaaatgccaagttt
tatcttgaaaaagaggacattgagtacataaaatcttcaaaattactccatatcacaggg
atgtacaaagaagttgttgaagaagcatcaaaacacgcaaatctcctttctttaaatcct
ggaactttactatcctcctacggacttaaaaccttggataaaatcataaaaaaagcccat
atcatttttttaaataaaaaagaggtcaaaatattgacaggattaaattttaatgaagga
tcgcagactattttgaatatgggcgtacccatagttgttgtaacatgtggaaagagtgga
gcgactgtttatactgaaaatgacgtgataagttctcctactgggggggttgaagctctg
gacacgacaggggcgggagatgcttttgctgcgggttttattgcatccttcgtcaaagac
aaaaagcttgaagattgtcttaaaatggggaatattgttgctgcacaatgtgttggaaga
ttaggggctttaaaataa

DBGET integrated database retrieval system