KEGG   Methanobacterium sp. SWAN-1: MSWAN_1748Help
Entry
MSWAN_1748        CDS       T01509                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSWAN_1748
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSWAN_1748
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MSWAN_1748
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MSWAN_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1843309..1844508
Genome map
AA seq 399 aa AA seqDB search
MIRCISCGAEYGLDEIIYTCPKCGSILEVVPLRPDVSKDVFECRKSTMWKYKEFMPVDES
KIVSLEEGGTPFCKCQKLGDELGVELYVKVEGSNPTGSFKDRGMSVGITKAMELGVDTVG
CASTGNTSASLAAYATRAGKRCIVLLPSGKVALGKLAQAMFHGAEVISIKGNFDEALEAI
TALALQGKLYLLNSINPFRLEGQKSIGFEIVDDLGWKSPDRIILPVGNAGNISAIWKGVK
EFYEAGFINDLPMMTGIQAEGAAPIANAVRAGKNEIVPVENPETIATAIRIGAPVSSVKA
LRAIYDSDGLAETVTDDEILSAQKLLARTEGIGVEPASAASIAGLKKLVETGSIDKGEQI
VCVVTGHLLKDPNTAIDACVKPVEVDADINALLSIITGK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgataagatgcatatcatgcggcgcagaatacggcctagatgagataatatacacatgc
ccaaagtgtggatcaatattagaagttgtaccgctcagaccagacgtttcaaaggacgtt
tttgagtgtagaaaatcaaccatgtggaagtacaaagagttcatgccagtggacgagtca
aagatagtaagccttgaagaagggggaacacccttctgtaaatgccagaaactcggagat
gaacttggagtagaattatacgtaaaagtagaaggatcaaacccaacaggaagctttaaa
gatagaggaatgagtgttgggataacaaaagccatggaactgggtgtggacacagttgga
tgtgcatcaacaggtaacacatcagcatcccttgcagcttacgcaacaagagcaggaaaa
cgatgcattgtacttttaccctctggaaaggttgcactcggaaagcttgcccaggcaatg
ttccacggtgcagaggtaatatccataaaaggaaactttgacgaggcacttgaagccata
acagccctcgcacttcagggaaaattatacctcctgaactccataaaccccttccgactt
gaagggcaaaaatccattggatttgagatagttgatgatttgggatggaaatcacctgat
aggataatattacccgttggaaatgccggcaacatatctgcaatatggaaaggtgtaaaa
gaattctacgaagcaggttttattaatgatcttccaatgatgacaggtattcaggcagaa
ggtgctgcacccatagccaacgctgtacgtgcaggtaaaaatgaaattgtaccagttgaa
aacccagagaccattgcaacagccataaggatcggagcacctgtaagctcagttaaagcc
ttaagagccatatatgattctgatgggcttgctgaaacagttacagacgatgaaatctta
agcgcacagaaactccttgcaagaacagagggaataggcgtggagccggcatccgcagca
tccattgcaggtcttaaaaagcttgttgagactggctcaatagataagggagaacaaatc
gtttgtgttgtcacaggacacttgttaaaggatcccaacacagcaatagatgcatgtgta
aaacctgttgaggttgatgcagatattaatgcccttttaagtattattactggtaagtaa

DBGET integrated database retrieval system