KEGG   Methanobacterium paludis: MSWAN_1748Help
Entry
MSWAN_1748        CDS       T01509                                 

Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mew  Methanobacterium paludis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MSWAN_1748
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSWAN_1748
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MSWAN_1748
Enzymes [BR:mew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MSWAN_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1843309..1844508
Genome map
AA seq 399 aa AA seqDB search
MIRCISCGAEYGLDEIIYTCPKCGSILEVVPLRPDVSKDVFECRKSTMWKYKEFMPVDES
KIVSLEEGGTPFCKCQKLGDELGVELYVKVEGSNPTGSFKDRGMSVGITKAMELGVDTVG
CASTGNTSASLAAYATRAGKRCIVLLPSGKVALGKLAQAMFHGAEVISIKGNFDEALEAI
TALALQGKLYLLNSINPFRLEGQKSIGFEIVDDLGWKSPDRIILPVGNAGNISAIWKGVK
EFYEAGFINDLPMMTGIQAEGAAPIANAVRAGKNEIVPVENPETIATAIRIGAPVSSVKA
LRAIYDSDGLAETVTDDEILSAQKLLARTEGIGVEPASAASIAGLKKLVETGSIDKGEQI
VCVVTGHLLKDPNTAIDACVKPVEVDADINALLSIITGK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgataagatgcatatcatgcggcgcagaatacggcctagatgagataatatacacatgc
ccaaagtgtggatcaatattagaagttgtaccgctcagaccagacgtttcaaaggacgtt
tttgagtgtagaaaatcaaccatgtggaagtacaaagagttcatgccagtggacgagtca
aagatagtaagccttgaagaagggggaacacccttctgtaaatgccagaaactcggagat
gaacttggagtagaattatacgtaaaagtagaaggatcaaacccaacaggaagctttaaa
gatagaggaatgagtgttgggataacaaaagccatggaactgggtgtggacacagttgga
tgtgcatcaacaggtaacacatcagcatcccttgcagcttacgcaacaagagcaggaaaa
cgatgcattgtacttttaccctctggaaaggttgcactcggaaagcttgcccaggcaatg
ttccacggtgcagaggtaatatccataaaaggaaactttgacgaggcacttgaagccata
acagccctcgcacttcagggaaaattatacctcctgaactccataaaccccttccgactt
gaagggcaaaaatccattggatttgagatagttgatgatttgggatggaaatcacctgat
aggataatattacccgttggaaatgccggcaacatatctgcaatatggaaaggtgtaaaa
gaattctacgaagcaggttttattaatgatcttccaatgatgacaggtattcaggcagaa
ggtgctgcacccatagccaacgctgtacgtgcaggtaaaaatgaaattgtaccagttgaa
aacccagagaccattgcaacagccataaggatcggagcacctgtaagctcagttaaagcc
ttaagagccatatatgattctgatgggcttgctgaaacagttacagacgatgaaatctta
agcgcacagaaactccttgcaagaacagagggaataggcgtggagccggcatccgcagca
tccattgcaggtcttaaaaagcttgttgagactggctcaatagataagggagaacaaatc
gtttgtgttgtcacaggacacttgttaaaggatcccaacacagcaatagatgcatgtgta
aaacctgttgaggttgatgcagatattaatgcccttttaagtattattactggtaagtaa

DBGET integrated database retrieval system