KEGG   Methanobacterium sp. SWAN-1: MSWAN_1783Help
Entry
MSWAN_1783        CDS       T01509                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_1783
   01230 Biosynthesis of amino acids
    MSWAN_1783
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1783
   00030 Pentose phosphate pathway
    MSWAN_1783
   00051 Fructose and mannose metabolism
    MSWAN_1783
  Energy metabolism
   00680 Methane metabolism
    MSWAN_1783
Enzymes [BR:mew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MSWAN_1783
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MSWAN_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1872550..1873647)
Genome map
AA seq 365 aa AA seqDB search
MKTTVSVIKADVGSVAGHAVTHGALLKKCDEILAKAKEEELLTDYYITNCGDDIDLIMTH
KNGEENEEVHELAFNAFMEATKVAKSLKLYGAGQDILSDTFSGNIKGMGPGCAEMEFKER
PSDPVFVFCCDKTEPGAFNLPVFRMFADPFNTAGLVIDPSLHGGYDFEIFDVIEHRKVTM
SCPDEMYDALALLGSIGRYIIKHVTRRSDGEIAASISTERLNLMAGKYIGKDDPVAIVRS
QSGFPAAGEVVEPFAFPHLVGGWMRGSHNGPLMPVSQAQAHPVRFDGPPRIISLGFQVSD
ARLIGPLDMFDDPAFDNSRKTASDVADYMRRHGPFEPHRLPADEMEYTSLPGVLEKLEDR
FEDMD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacggttagcgtaataaaagcagatgttggtagtgttgcaggacacgcagtg
actcacggagccctgcttaaaaaatgtgatgaaatacttgcaaaagcaaaggaagaagaa
cttctaacagactattatattacaaactgcggagatgacatagatcttataatgactcac
aaaaatggtgaggaaaacgaggaagtccatgaacttgcatttaatgcatttatggaagcc
acaaaagttgcaaaaagcctcaaactctatggtgcaggtcaggatatattgtccgacaca
ttctcaggtaacatcaaaggaatgggaccaggatgtgcagagatggaattcaaagaaagg
ccatccgacccagtatttgttttttgctgcgacaaaacagaacccggtgcattcaacctt
ccggttttcaggatgtttgcagacccattcaacacagcaggacttgtaattgacccatca
ctccatggtggatatgatttcgaaatattcgacgtcattgaacacagaaaggtcacaatg
tcatgtccagatgagatgtacgatgctctggcacttttaggttcaataggaaggtatatt
ataaaacacgttacaagaagaagcgacggcgaaatagcagcttcaataagcacagaaaga
ctcaacctcatggcaggaaaatacataggaaaagacgaccctgttgcaattgtaaggtca
caatcaggtttccctgcagctggagaagttgttgagccattcgcattcccacaccttgta
ggtggatggatgaggggttcacacaacggtccattaatgccagtttcccaagcacaggct
caccctgtaaggtttgacggcccaccacggataatatctttaggtttccaggtttcagat
gcaagactcatcggacctcttgacatgtttgatgaccctgcattcgacaattcaaggaaa
actgcatcggatgtagctgattacatgagaagacacggcccattcgagccacaccggtta
ccagctgacgagatggaatacaccagtctcccaggggtacttgaaaaactcgaagacaga
tttgaagatatggattaa

DBGET integrated database retrieval system