KEGG   Methanobacterium paludis: MSWAN_1837Help
Entry
MSWAN_1837        CDS       T01509                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mew  Methanobacterium paludis
Pathway
mew00010  Glycolysis / Gluconeogenesis
mew00620  Pyruvate metabolism
mew00640  Propanoate metabolism
mew00680  Methane metabolism
mew00720  Carbon fixation pathways in prokaryotes
mew01100  Metabolic pathways
mew01110  Biosynthesis of secondary metabolites
mew01120  Microbial metabolism in diverse environments
mew01130  Biosynthesis of antibiotics
mew01200  Carbon metabolism
Module
mew_M00357  Methanogenesis, acetate => methane
mew_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1837
   00620 Pyruvate metabolism
    MSWAN_1837
   00640 Propanoate metabolism
    MSWAN_1837
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_1837
   00680 Methane metabolism
    MSWAN_1837
Enzymes [BR:mew01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MSWAN_1837
Lipid biosynthesis proteins [BR:mew01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MSWAN_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: AEG18848
JGI: MSWAN_1837
UniProt: F6D4X7
Position
1925545..1927515
Genome map
AA seq 656 aa AA seqDB search
MYLIRVEGDKMSKDLDTLLREKRIFKPSSDVVKSSNIHKWMEKHEINDYDELLQKALDNP
DWFWDELAGELEWFKQYKKTKKWNPPYAEWFLDGKFNIVYNALDKHAKGPEKDKLAYIWE
GESGEVRELTYLDLYREVNRFANVLKKLGVRKGDTVSIYLPMILELPIAMLACAKIGAVH
SVVFSGFWAKAFQERINDAKSKVAITVDGFRRRGKLIELKENVDNILDKTPTIEKLIVVR
HEGLNINMQEGKDIWWHEAITEMETECKTEEMDSEDPLFILYTSGTTGKPKGVVHVHGGY
AVGIYTTLKFVFDLKEDDVWWCAADIGWVTGHSYIVYGPLLLGVTSILYEGTPDYPDPGR
LWKMIENYGVTVFYTAPTTIRMFMKFGEKWPQKYNLDSLRLLGTVGEPINPEAWIWYHQH
IGGGRCPVMDTWWQTETGMHIITPLPISELKPGSAVKPFPTVEADVLDDAGKSITGGGGH
LVIKSTWPSMFRTLYKDPERYVESYWSRFPNIYLSGDVARRDDEGYFWIQGREDDVLNVA
GHRISTAEVESAIVSHKSVAEAAVVGKPHDIKGEEICAFVILKEGSGSTEDFEDIIKYHV
RKEIGPIASPAHVKIVKDLPKTRSGKIMRRVIKAKVKGEPVGDTSTLANPEAVEYL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
ttgtacttaataagagtagaaggagataaaatgtcgaaggacttagatactctacttagg
gaaaaaaggatattcaaaccgtcatctgatgttgtaaaatcaagtaacatccataaatgg
atggaaaaacacgaaatcaatgattacgatgaactgctccaaaaagcattggacaaccca
gattggttctgggatgagcttgcaggggagcttgaatggtttaaacagtacaaaaagacc
aaaaaatggaatcctccgtatgcagaatggtttttggatggtaaatttaacatagtttac
aatgcgctggataaacatgcaaaaggccctgaaaaggacaaattagcttatatatgggaa
ggagaatctggagaagttcgtgaattaacttatttagacctttacagggaagttaacaga
tttgcgaatgttttaaagaaacttggagttcgtaagggggacactgtaagcatttacttg
cccatgatacttgaacttccaatcgcaatgcttgcatgtgcaaaaattggggctgttcac
tcggtggttttctccggtttctgggccaaggccttccaggaacggataaacgatgcaaaa
tccaaggttgcaataactgtagatggcttcagaagaagggggaaacttatagagctaaaa
gaaaatgtggacaacatcctcgataaaacccccacaatagaaaaactcatagttgtaaga
catgaaggcctcaatatcaacatgcaggaaggtaaggacatctggtggcatgaagccatt
actgaaatggagacagaatgcaaaacagaagaaatggattctgaagaccctttatttatt
ttgtacacctcaggaaccacaggaaaacccaagggggttgtacatgtccacggaggatac
gcagtaggtatttacacaactttaaaatttgtttttgaccttaaagaagatgatgtatgg
tggtgcgcagcagatataggctgggtaacaggccacagctacatagtctacggcccactc
cttcttggtgtaacatccatactttacgagggtacaccagattatcctgaccctggaagg
ctctggaagatgattgaaaactatggtgtgactgttttctacacagcccccacaaccata
aggatgttcatgaagttcggggagaaatggccgcaaaaatataacctggattctttaagg
cttttaggaactgtgggagaacctataaatccagaagcatggatatggtaccatcaacac
attgggggcggtagatgtcctgtgatggacacatggtggcaaacagagactggaatgcac
attataacaccattacccatttcggagcttaaaccaggctctgctgtaaagccatttcca
actgttgaagcagatgttctggacgatgcaggtaaatccatcactggaggtggaggacac
cttgtaataaaatctacatggccttcaatgtttagaactctttacaaggatcctgaaagg
tacgttgaatcatactggagcagattccccaacatttacctcagtggagacgtggcacgc
agagatgatgagggctacttctggattcagggtagagaagacgacgtgctgaacgttgcg
gggcacagaataagcactgccgaggttgaatctgccattgtaagccataaatccgttgca
gaagctgcagtagttggtaaaccacatgatattaaaggtgaggaaatttgtgccttcgtt
atacttaaggaaggatccggttctacagaagactttgaggacataattaaataccacgta
agaaaagagataggcccaattgcaagcccagcccatgtgaaaattgttaaagacctgccc
aaaacacgttcaggtaaaataatgcgaagggtgataaaagctaaggtaaaaggagaaccc
gtaggtgatacaagcacgcttgcaaatcctgaagctgtagaatatctttga

DBGET integrated database retrieval system