KEGG   Methanobacterium sp. SWAN-1: MSWAN_1906Help
Entry
MSWAN_1906        CDS       T01509                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_1906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1906
   00020 Citrate cycle (TCA cycle)
    MSWAN_1906
   00620 Pyruvate metabolism
    MSWAN_1906
   00640 Propanoate metabolism
    MSWAN_1906
   00650 Butanoate metabolism
    MSWAN_1906
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_1906
   00680 Methane metabolism
    MSWAN_1906
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MSWAN_1906
Enzymes [BR:mew01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MSWAN_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2003959..2004201
Genome map
AA seq 80 aa AA seqDB search
MVSIGAAVKKPGSTTKNKTGSWRTFKPILDKEKCIECENCVLFCPEGCINKEYDIDYDFC
KGCGICAEECPVKAIKMERE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaattggagcagctgttaaaaaacctggaagtaccactaaaaataaaacaggt
agctggagaacatttaaaccaattttggacaaggaaaaatgtatagaatgcgaaaattgt
gttcttttctgtccggaaggctgtataaataaagaatatgacatagactacgacttttgt
aaagggtgcggcatatgcgccgaagaatgccctgtaaaagctataaaaatggagagggaa
taa

DBGET integrated database retrieval system