KEGG   Methanobacterium paludis: MSWAN_1908Help
Entry
MSWAN_1908        CDS       T01509                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mew  Methanobacterium paludis
Pathway
mew00010  Glycolysis / Gluconeogenesis
mew00020  Citrate cycle (TCA cycle)
mew00620  Pyruvate metabolism
mew00633  Nitrotoluene degradation
mew00640  Propanoate metabolism
mew00650  Butanoate metabolism
mew00680  Methane metabolism
mew00720  Carbon fixation pathways in prokaryotes
mew01100  Metabolic pathways
mew01120  Microbial metabolism in diverse environments
mew01130  Biosynthesis of antibiotics
mew01200  Carbon metabolism
Module
mew_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mew_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1908
   00020 Citrate cycle (TCA cycle)
    MSWAN_1908
   00620 Pyruvate metabolism
    MSWAN_1908
   00640 Propanoate metabolism
    MSWAN_1908
   00650 Butanoate metabolism
    MSWAN_1908
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_1908
   00680 Methane metabolism
    MSWAN_1908
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MSWAN_1908
Enzymes [BR:mew01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MSWAN_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEG18917
JGI: MSWAN_1908
UniProt: F6D5W4
Position
2005358..2006221
Genome map
AA seq 287 aa AA seqDB search
MEISEKEFLAPGHRACAGCGATIGVRLALKVLGENTVAVSATGCLEVVTTPYPETAWRIP
WIHVAFENAAAVASGVEAAFKTLGRDSNIVVFGGDGGTVDIGLQALSGAMERGHNIIYIC
YDNEAYMNTGIQRSGATPYGASTTTSPAGKQSFGEDKPKKNMPMIMAAHGVPYVATASIA
YPEDFMNKVKKASEVDGPAYIHLHQPCTTGWGYKPSKTIDMGRLAVETGSWILYEIEEGE
FKVTYRPMQRKPVNVYLEAQKRFKHLTDEEKARIQSLVDSICTELKI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggagataagtgaaaaagaatttcttgcaccaggacacagggcatgcgctggatgcggc
gccaccataggcgtcaggctcgcgcttaaagtgctgggtgaaaacactgttgcagtatct
gcaacaggatgtttagaagttgtaacaacaccttatcctgaaactgcatggagaattcct
tggattcacgttgcattcgaaaacgctgcagccgttgcatccggagttgaagcagcattt
aaaacccttggaagagattctaacatagtggtctttggtggagatggtggaacagttgac
ataggacttcaagcactatctggagccatggaaaggggacataacataatttacatttgt
tacgataatgaagcttacatgaacacgggtatacagaggagcggtgcaacaccctacggc
gcatcaacaacaacctcacctgcaggtaagcaaagtttcggtgaggacaaaccaaaaaag
aacatgccaatgataatggccgcccatggagtgccttacgttgcaacagcatcaatagca
taccctgaagatttcatgaataaggttaaaaaagcatcagaagttgatggaccagcatat
attcacctccaccaaccatgtacaacaggttggggttacaaaccttcaaaaaccatagat
atgggaaggttagctgttgaaaccggttcatggatactttatgaaattgaagaaggtgag
ttcaaggttacatacaggccaatgcaaagaaaacctgtcaatgtatatcttgaagcacag
aaaagatttaaacacttaacagatgaggaaaaagccaggattcaaagccttgtggattct
atctgcactgagcttaaaatatag

DBGET integrated database retrieval system