KEGG   Methanobacterium sp. SWAN-1: MSWAN_1908Help
Entry
MSWAN_1908        CDS       T01509                                 

Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSWAN_1908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSWAN_1908
   00020 Citrate cycle (TCA cycle)
    MSWAN_1908
   00620 Pyruvate metabolism
    MSWAN_1908
   00640 Propanoate metabolism
    MSWAN_1908
   00650 Butanoate metabolism
    MSWAN_1908
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSWAN_1908
   00680 Methane metabolism
    MSWAN_1908
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MSWAN_1908
Enzymes [BR:mew01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MSWAN_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2005358..2006221
Genome map
AA seq 287 aa AA seqDB search
MEISEKEFLAPGHRACAGCGATIGVRLALKVLGENTVAVSATGCLEVVTTPYPETAWRIP
WIHVAFENAAAVASGVEAAFKTLGRDSNIVVFGGDGGTVDIGLQALSGAMERGHNIIYIC
YDNEAYMNTGIQRSGATPYGASTTTSPAGKQSFGEDKPKKNMPMIMAAHGVPYVATASIA
YPEDFMNKVKKASEVDGPAYIHLHQPCTTGWGYKPSKTIDMGRLAVETGSWILYEIEEGE
FKVTYRPMQRKPVNVYLEAQKRFKHLTDEEKARIQSLVDSICTELKI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggagataagtgaaaaagaatttcttgcaccaggacacagggcatgcgctggatgcggc
gccaccataggcgtcaggctcgcgcttaaagtgctgggtgaaaacactgttgcagtatct
gcaacaggatgtttagaagttgtaacaacaccttatcctgaaactgcatggagaattcct
tggattcacgttgcattcgaaaacgctgcagccgttgcatccggagttgaagcagcattt
aaaacccttggaagagattctaacatagtggtctttggtggagatggtggaacagttgac
ataggacttcaagcactatctggagccatggaaaggggacataacataatttacatttgt
tacgataatgaagcttacatgaacacgggtatacagaggagcggtgcaacaccctacggc
gcatcaacaacaacctcacctgcaggtaagcaaagtttcggtgaggacaaaccaaaaaag
aacatgccaatgataatggccgcccatggagtgccttacgttgcaacagcatcaatagca
taccctgaagatttcatgaataaggttaaaaaagcatcagaagttgatggaccagcatat
attcacctccaccaaccatgtacaacaggttggggttacaaaccttcaaaaaccatagat
atgggaaggttagctgttgaaaccggttcatggatactttatgaaattgaagaaggtgag
ttcaaggttacatacaggccaatgcaaagaaaacctgtcaatgtatatcttgaagcacag
aaaagatttaaacacttaacagatgaggaaaaagccaggattcaaagccttgtggattct
atctgcactgagcttaaaatatag

DBGET integrated database retrieval system