KEGG   Methanobacterium sp. SWAN-1: MSWAN_2057Help
Entry
MSWAN_2057        CDS       T01509                                 

Definition
methyl-coenzyme M reductase subunit gamma (EC:2.8.4.1)
Orthology
K00402  
methyl-coenzyme M reductase gamma subunit [EC:2.8.4.1]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, methanol => methane
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mew01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mew00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2156770..2157519)
Genome map
AA seq 249 aa AA seqDB search
MAQYYPGTSQVAQNRRNLSNPDYELEKFREISDEDVVKILGHRAPGEEYPSVHPPLEEMD
EPDDAIREMVEAVDGAKAGDRVRYIQFVDSMYNAPAQPFVRSRAYLHRYRGADAGTLSGR
QIIEARERDLEKISKELLETEFFDPARTGIRGQSVHGHSLRLDEDGVMFDMLRRQILNKE
TGKVEAVKDQIGDELDEPVVLGEPLDDATLKAKTTIYRVDGEAYRDDKDAVEVLHRIHVR
RSQGGYKPE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatattatcccggaactagtcaggttgctcaaaaccgaagaaatttaagtaac
cctgattatgaactagaaaaatttagagaaatctcagacgaagatgttgtaaagatatta
ggtcacagagctcctggtgaggagtacccaagtgtacacccaccactagaagaaatggat
gaaccagatgacgctataagagaaatggttgaagctgttgacggtgcaaaagccggtgac
agggtaagatacattcagttcgttgactcaatgtacaacgccccagctcagccattcgta
agatcaagagcctacttacacagatacagaggagctgacgcaggtacactatctggaagg
cagatcatcgaagcaagggaaagagaccttgagaaaatctccaaggaacttcttgaaaca
gaattcttcgacccagcccgtacgggtataaggggtcaaagtgttcacggtcactctctc
aggctcgatgaagacggtgttatgttcgacatgttaagaaggcagatcctgaacaaagaa
accggaaaagttgaagctgtaaaagatcagatcggtgacgagcttgatgaacctgttgtt
ttaggtgaaccactagatgacgctacacttaaagcaaaaacaactatctacagggtagat
ggtgaagcttacagagacgacaaagacgcagtagaagtactccacagaatacacgtaaga
agatcacaaggcggatacaaacctgaataa

DBGET integrated database retrieval system