KEGG   Methanobacterium paludis: MSWAN_2403Help
Entry
MSWAN_2403        CDS       T01509                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mew  Methanobacterium paludis
Pathway
mew00240  Pyrimidine metabolism
mew00250  Alanine, aspartate and glutamate metabolism
mew01100  Metabolic pathways
Module
mew_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mew00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MSWAN_2403
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSWAN_2403
Enzymes [BR:mew01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MSWAN_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace ThiI
Motif
Other DBs
NCBI-ProteinID: AEG19405
JGI: MSWAN_2403
UniProt: F6D6H2
Position
2497102..2498025
Genome map
AA seq 307 aa AA seqDB search
MDFNQKDIISIRDFSKEDIEYILDVAEKMEPVARSKKRSNVLSGNILGMLFYEPSTRTRL
SFETAMKRLGGSTIGFAEANVSSATKGENLADTAKIISEYADAIVIRHNMEGAARFVADV
VDVPVINAGDGAGQHPTQTLLDLYTMKRVLGRTENLHVSLIGDLKYGRTVHSLAYALAMF
GVDMSFVSPTELRMPQSIVHDLSKTGVSVEETESIHDVIDKTDVLYVTRIQKERFPDPEE
YSKIKGAYMIDLKLLKGTNAIVMHPLPRISEIAPEVDNTAYGRYFEQAFYGVPVRMAILS
LLMDKIE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggactttaatcagaaagatatcatttcaattagggatttcagcaaagaagatattgaa
tatattttagatgttgcagaaaagatggaacccgttgcaaggtcaaaaaaacgatcaaac
gttctttcaggaaatatccttggaatgttattttatgaaccttcaaccagaacaaggctt
tcatttgaaactgcaatgaaaagattgggcggtagtacgatcggatttgcggaagcaaat
gtgagttcagctacaaaaggagaaaatttagctgacacagccaaaataataagtgaatat
gctgacgctattgttataagacataatatggaaggtgcagcacgttttgtggctgatgtt
gttgatgtaccggttataaatgcaggtgatggggctggacagcacccaacacagacactt
cttgacctttacacaatgaagagggtgcttggaagaactgaaaacttgcacgtttcatta
attggagacctgaaatacggaagaactgtgcattcattggcatatgcccttgcaatgttt
ggtgttgatatgagcttcgtatctccaactgaactgagaatgccacaaagtatagtgcac
gatttaagcaagacaggagtttcagttgaagaaacagaaagtatacatgacgtaattgac
aaaactgatgttttgtatgtgactaggattcaaaaagagcgattcccagatcctgaagag
tactccaagatcaaaggggcttatatgatagatctaaaacttctcaaaggtacaaatgcc
attgtgatgcatccactaccaagaatcagtgaaatagcccctgaagtggacaacacagcc
tatggaagatatttcgaacaagctttttatggggttccagtgcgtatggctattttaagc
ttgttaatggataaaattgagtga

DBGET integrated database retrieval system