KEGG   Methanobacterium sp. SWAN-1: MSWAN_2408Help
Entry
MSWAN_2408        CDS       T01509                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mew  Methanobacterium sp. SWAN-1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mew00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2503232..2503858)
Genome map
AA seq 208 aa AA seqDB search
MDKKEVLRKITDVSNYLYEKGLVPGKSGNVSFRFVANGSENVAITPSGVSLKDVDEKNIV
IVDMDGNKLNESLENDKKASSEVFMHINVYKKNDEVNGIVHTHSPVATGFAFAEEKIKRL
EGFGTIKNPFIPFVEYATPGTMELAENVSKALENEDVVLLKRHGIVACGENLDDAFLLAE
FVEETAKIQLVSSLLSRGQTQAHLKRSI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagaagttttaagaaaaattactgacgtatcaaactatttgtatgaaaaa
ggacttgtaccgggaaaatctggaaatgtgagttttagattcgttgctaatggttcagaa
aatgtggctataacccctagcggagtctcactcaaagatgtggatgaaaaaaacatcgta
attgttgatatggatggtaataaattaaatgaaagccttgaaaatgataaaaaagcttct
tcagaagttttcatgcatatcaacgtttataaaaaaaatgatgaagtgaatggaattgtt
catacacattctccagttgcaacaggatttgcatttgctgaagaaaaaattaaaaggtta
gaaggttttggaactattaaaaatccatttattcctttcgtagagtatgcaaccccaggt
actatggagcttgccgaaaatgtttcaaaagctctggaaaatgaggacgttgtgctttta
aagaggcacggtattgttgcctgtggagaaaatttagatgatgctttccttcttgcagaa
tttgtggaagagacagctaaaatacaacttgtgtccagtttactcagtcgtggacagact
caagctcacttaaaacgttccatataa

DBGET integrated database retrieval system