KEGG   Methylobacterium extorquens PA1: Mext_0009Help
Entry
Mext_0009         CDS       T00640                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mext_0009
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mext_0009
DNA repair and recombination proteins [BR:mex03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mext_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD HHH_2 AAA_16 AAA_29 HHH_3 PIF1 TrwB_AAD_bind NTPase_1 T2SSE AAA_28 IstB_IS21 ArgK CbiA AAA_22 AAA UvrD_C HHH DUF853 RsgA_GTPase AAA_24 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABY28438
JGI: Mext0009
UniProt: A9W775
Position
8303..10504
Genome map
AA seq 733 aa AA seqDB search
MNTSVRPSDLDCGTPLDMLAGSVERVTFHSAETGFCVLKIHARGRRDLVPVVGHAPAIAA
GEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQMRGIGPMMAKRIVACF
GEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIMIFLHAHGVGTARATRIF
RTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARDAPQRLAAGVSYALQTAMD
EGHCGLPVERLVRLAAELLDVAPDLVRLAAALVLREGREVVADTLRGEPCLFLKGLHGAE
RVIAMRLAERAAGLPPWAAIDFALARPWVEAKTGKTLSASQAEAVGLVLRSKLCVLTGGP
GVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQTGLEARTLHRLLEIDPRNGGFQ
RNEDNPLDCDLLVIDETSMVDVPLMHALLKAVPERAGLILVGDVDQLPSVGPGQVLADVI
ASGTVPVARLTEIFRQAAQSRIVVNAHSINTGRMPAAPAKGEDSDFYLVEIEDADEGVET
LIELVTRRIPRRFGLDPTRDIQVLTPMIRGSLGSRNLNNALQRVLNPSPSAEVERFGWRF
APGDRVMETRNDYDRDVFNGDLGTISAIDAEDEALVVDFDGRAVIYPFNELDTLVPAFAT
TIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGVTRGRRLVVLIGQRRALAMAVREGTSR
RRWTKLREWLDAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcagtccgtcccagcgacctcgattgcggtacgcccctcgacatgctcgcc
ggctcggttgagcgggtgacgttccacagcgccgagaccggcttctgcgtcctcaaaatc
catgcccgcggccggcgcgacctcgtgccggtggtgggtcacgccccggccatcgccgcg
ggcgagtggctgacggcctccgggcgatgggtcacggaccgtgagcacggcctccagttc
cgcgccgacacgctccaagtgacgccgcccacggggatcgaaggcatcgagcgctacctc
gcgtccgggcagatgcgcggcatcggcccgatgatggccaagcgcatcgtcgcctgcttc
ggcgaggcggtgttcgagatcatcgaggccgagcccgcccgcctcaccgaggtcgagggc
atcggccgcaagcgcgccgcgcgcatcgtcaagggctgggccgagcagaaggccgtgcgg
gagatcatgatcttcctgcacgcccacggcgtcggcaccgcgcgggcgacccggatcttc
cgcacgtatggcggggattccctgaaggtcatggccgaggatccctatcggctcgcccgc
gacatccgcggcatcggcttccgcacggcggacgccatcgccctgcgccttggcctcgcc
cgcgacgcgccgcagcggctcgctgccggtgtctcctacgcactccagacggcgatggat
gagggccattgcggcctgcccgtcgagcggctggtgcgcctcgctgccgagcttctcgac
gtcgcgcccgatctcgtccggctcgccgcggcgctcgtcctgcgcgagggccgcgaggtc
gtcgcggatacgctgcgcggcgagccctgcctgttcctgaagggcctgcacggcgccgag
cgcgtcatcgcgatgcggctggccgagcgcgccgccggcctgccaccctgggccgcgatc
gacttcgcgctggccaggccctgggtcgaggcgaagaccggaaagacgctgtccgcctcg
caggccgaggcggtcgggctggtgctccgttcgaagctctgcgttctcaccggcggcccc
ggcgtcggcaagaccagcaccctcgacgcgatcctgcgcatcctcaccgccaagggcgtg
cgggtgctgctcgccgcccccaccggccgggcggccaagcgcatggccgagcagaccggg
ctggaagcacgcacgctccatcggctgctggagatcgacccgcgcaatggcggctttcag
cgcaacgaggacaacccgctcgattgcgatctcctcgtcatcgacgagacctcgatggtt
gacgtgccgctgatgcatgccctcctcaaagccgtgccggagcgagcgggcctgatcctc
gtcggcgatgtcgaccagcttccctcggtcggacccggacaggtgctcgccgacgtgatt
gcctccggaaccgtgccggtggcgcgccttaccgagatttttcgccaagcggcgcagagc
cggatcgtcgtcaacgcccacagcatcaacaccgggcggatgccggctgcgcccgccaag
ggcgaggacagcgacttctacctcgtcgagatcgaggacgcggacgagggcgtggagacg
ctgatcgaactcgtcacccgccgtatcccccgccgcttcggcctcgatcccacccgcgac
atccaagtgttgacgccgatgatccgcggctcgctcggcagccgcaatctcaacaacgcc
cttcagcgcgtgttgaatccgtcgccctcggcggaggtcgaacgcttcggctggcgcttt
gcgcccggcgaccgggtgatggagacccgcaacgactacgaccgcgacgtgttcaacggc
gacctcggtacgatcagcgccatcgacgcggaggacgaggcgctcgtggtcgatttcgac
ggtcgcgcggtgatctacccgttcaacgaactcgacacgttggtcccggccttcgccacg
acgatccacaaggcgcaaggctcggaatatccggctgtggtgatcccggtggtgacccag
catcgcacgatgctcgcgcgcaacctgctctataccggcgtcacccgcgggcgccgcctc
gttgtgctgatcggccagcgccgggcccttgcgatggcggtccgcgaagggacctcgcgg
cggcgttggaccaagctgcgggagtggctggacgcggcctga

DBGET integrated database retrieval system