KEGG   Methylobacterium extorquens PA1: Mext_0052Help
Entry
Mext_0052         CDS       T00640                                 

Definition
phosphate butyryltransferase (EC:2.3.1.19)
Organism
mex  Methylobacterium extorquens PA1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
59158..60132
Genome map
AA seq 324 aa AA seqDB search
MSIATIEQAAVETRGHEKYDRLIVAAQALPRLQVAVVHPCDAATLGAALEASALGIVEPI
LVGPPGKIAAAAAALDADIGAFRLVDAAHSHEAAQKAVALVRAGEAESLMKGSLHTDELM
AAVVRQDGGLRTARRVSHCFVMDVPGHATPLIITDAAVNIAPSLEEKRDITQNAIDLAQA
LGVESVRVAILSATESINAKMPSTLDAAALCKMADRGQITGGILDGPLALDNAIDLEAAR
IKKIHSPVAGQANVLVVPDLEAGNMLAKSLTFLARADAAGIVLGARVPIILTSRADSRLT
RLASCAVASLFAAAQRARLPLPEV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgattgcgaccatcgaacaggcagcggtcgaaacccgcggacacgagaaatatgac
cgtctgatcgtggctgcccaggcgctgccgaggcttcaggtcgccgtcgtccatccctgc
gacgcggctacactaggggcggcgctcgaagcctccgcgctcggaatcgtcgaaccgatt
ctggtgggcccaccgggaaagatcgccgccgccgcggccgcactcgatgcggatatcggc
gcgttccggctcgtcgacgccgctcacagccacgaggccgctcagaaggccgtggctctc
gtgcgcgccggcgaggccgagtccctcatgaaggggagcctccacaccgacgagttgatg
gctgcggtggtgcgccaggacggcggcctaaggacggctcgccgcgtcagccactgcttc
gtcatggacgtgccgggccatgcgacgcccctgatcattacggacgccgcggtcaacatc
gcgccctcgctcgaggaaaagcgcgacatcacgcagaacgccatcgacctcgcacaagcc
cttggcgtcgagtcggtgcgggtcgccatcctgtcggcgacggaaagcatcaacgcgaag
atgccgtcgaccctcgatgccgcggccctctgcaagatggccgaccggggtcagatcacc
ggcggcatcctagacggccctcttgccctcgataatgccatcgacctcgaagcggctcgg
atcaagaagatccactcaccggtggccggccaagccaacgttctcgtggtccccgatttg
gaagccggcaacatgctggccaagagcttgaccttcctggcccgtgcggacgcggccggg
atcgtgcttggggctcgggtcccgatcatcctgacgagccgggccgattctcggctcacg
cgtctcgcctcctgtgcggtcgcctcactgttcgccgccgcccagcgcgcccgcctgccc
cttccggaggtctag

DBGET integrated database retrieval system