KEGG   Methylobacterium extorquens PA1: Mext_0058Help
Entry
Mext_0058         CDS       T00640                                 

Definition
(GenBank) peptidase M42 family protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(65450..66517)
Genome map
AA seq 355 aa AA seqDB search
MRHESLEYLKALANAPSPSGYEQGAAKLFREYTQRYADRVSVDSHGNIIAALNPDAPMKI
MLAAHMDEIGFVVHYIDEAGLLYFSAVGGHDSTIPPGQRVWVYGSERTPGVVGRKASHLL
DEDEQNKKPKLSDLWIDIGATSRAQVESVVRLGDPITYQYEFQSLLGDRAAARGFDNKAG
LFVVAEALRSLSEGGGLAPGVGVYFVASVQEEIGSRGARTSAFSIAAQTGLAIDVDHAID
YPGVSRTQHGELKIGEGPSVSRGPNTNPVVFDLLSRAAKEEGIPFQVSVSPSATPTDANA
MQLNRGGMAVGLLGVAIRYMHTPCELLSLTDLHQCIGLTSAYCRRVTQDTDFSPY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatgaatcgctggagtacctgaaagctcttgccaacgccccgtcccctagcggt
tacgagcagggagctgcaaagctctttcgggagtacacgcagcgctatgcggatcgcgtg
agcgtagattctcatggcaacatcatagcagcgctcaatcctgacgcgccgatgaagatc
atgcttgcggcgcatatggatgagatcgggttcgttgtgcactacatagatgaggccggg
cttctctattttagtgccgttggcgggcacgacagcactattccgcctggccagagggtc
tgggtatatggcagtgagcgtacgcctggcgttgttgggcgaaaggctagtcatcttctc
gacgaagacgagcaaaataaaaaaccaaagctgtccgacttgtggattgacataggcgca
acctcacgcgcgcaagttgaatctgttgtgcggcttggcgatccgattacataccagtac
gagttccaatccttgctgggagatcgcgctgcggcgcgagggtttgacaacaaggcaggc
ctgtttgttgtggccgaagctttgcgcagcctcagtgaggggggaggtctcgcacctggc
gttggcgtttatttcgtcgcgtcggttcaggaagaaatcggatcgcgtggcgcacgaacc
tcggccttcagcatagctgcacaaacgggacttgccatcgatgtggatcacgcaatcgac
tatccgggcgtgagtaggacacagcacggagaactcaagatcggcgagggtccgagcgtg
tcccgcgggcctaacacgaacccggttgtttttgatcttctgtcaagggcagcgaaggaa
gagggcatcccgtttcaggtgagtgtctcaccttccgccacgccgacagatgccaatgcg
atgcagcttaataggggaggaatggcagttggactcctgggcgttgcaatccgttacatg
cacactccatgcgaattgttgagcctaacagatttgcatcagtgtatcggcctgacatct
gcgtactgccgacgcgtaactcaagatacggatttttctccttactag

DBGET integrated database retrieval system