KEGG   Methylobacterium extorquens PA1: Mext_0058Help
Entry
Mext_0058         CDS       T00640                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mext_0058
Enzymes [BR:mex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mext_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(65450..66517)
Genome map
AA seq 355 aa AA seqDB search
MRHESLEYLKALANAPSPSGYEQGAAKLFREYTQRYADRVSVDSHGNIIAALNPDAPMKI
MLAAHMDEIGFVVHYIDEAGLLYFSAVGGHDSTIPPGQRVWVYGSERTPGVVGRKASHLL
DEDEQNKKPKLSDLWIDIGATSRAQVESVVRLGDPITYQYEFQSLLGDRAAARGFDNKAG
LFVVAEALRSLSEGGGLAPGVGVYFVASVQEEIGSRGARTSAFSIAAQTGLAIDVDHAID
YPGVSRTQHGELKIGEGPSVSRGPNTNPVVFDLLSRAAKEEGIPFQVSVSPSATPTDANA
MQLNRGGMAVGLLGVAIRYMHTPCELLSLTDLHQCIGLTSAYCRRVTQDTDFSPY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatgaatcgctggagtacctgaaagctcttgccaacgccccgtcccctagcggt
tacgagcagggagctgcaaagctctttcgggagtacacgcagcgctatgcggatcgcgtg
agcgtagattctcatggcaacatcatagcagcgctcaatcctgacgcgccgatgaagatc
atgcttgcggcgcatatggatgagatcgggttcgttgtgcactacatagatgaggccggg
cttctctattttagtgccgttggcgggcacgacagcactattccgcctggccagagggtc
tgggtatatggcagtgagcgtacgcctggcgttgttgggcgaaaggctagtcatcttctc
gacgaagacgagcaaaataaaaaaccaaagctgtccgacttgtggattgacataggcgca
acctcacgcgcgcaagttgaatctgttgtgcggcttggcgatccgattacataccagtac
gagttccaatccttgctgggagatcgcgctgcggcgcgagggtttgacaacaaggcaggc
ctgtttgttgtggccgaagctttgcgcagcctcagtgaggggggaggtctcgcacctggc
gttggcgtttatttcgtcgcgtcggttcaggaagaaatcggatcgcgtggcgcacgaacc
tcggccttcagcatagctgcacaaacgggacttgccatcgatgtggatcacgcaatcgac
tatccgggcgtgagtaggacacagcacggagaactcaagatcggcgagggtccgagcgtg
tcccgcgggcctaacacgaacccggttgtttttgatcttctgtcaagggcagcgaaggaa
gagggcatcccgtttcaggtgagtgtctcaccttccgccacgccgacagatgccaatgcg
atgcagcttaataggggaggaatggcagttggactcctgggcgttgcaatccgttacatg
cacactccatgcgaattgttgagcctaacagatttgcatcagtgtatcggcctgacatct
gcgtactgccgacgcgtaactcaagatacggatttttctccttactag

DBGET integrated database retrieval system