KEGG   Methylobacterium extorquens PA1: Mext_0341Help
Entry
Mext_0341         CDS       T00640                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mex  Methylobacterium extorquens PA1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mext_0341
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mext_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
385520..386437
Genome map
AA seq 305 aa AA seqDB search
MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPVGSAGYPLPDPEPKSGGAAAEAPKA
EPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAAL
KEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLRTLADSPKPLPAAE
KKAETAPAGDKKAETEKPAEGKPDAKKAVEDKKPAGTKPVESATGDKSKTPETNAPQGNT
QSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTKADPGSESTPATEPPAKPDP
DAPKP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagctgaacaaggttgcgggcgcggtcctgggtgccctcctgttcgcg
gttgggtcgggcttcgtggcggagctgatctatcacccgaagcccgtcggaagcgccggc
tatcctctgccggaccccgagccgaagagcggcggcgccgcggcggaagcgccgaaggcc
gagcccatcgccgtgcggctcgccagcgccgatgctgagaagggcaagggcggcaccaag
gcctgccaggcctgccacagcttcgagaagggcggccccaacaaggtcggccccgatctc
tgggagatcgtggagcgcgagaaggcgcatgccgccggcttcgattactccgccgcgctc
aaggagaagggcggcacctggacctacgaggatctcgaccacttcctcgaaagcccgaag
ggctacgtgaagggcaccaagatggcgtttgccggcatcggctcgccgacggaccgcgcc
aacgtcatcgcctatctgcgcacgctcgccgacagcccgaagccgctgccggccgccgag
aagaaggctgaaacggcgccggcaggcgacaagaaggccgagaccgagaagcccgccgag
ggcaagcccgacgccaagaaggccgtcgaggacaagaagcccgccgggaccaagccggtg
gagagcgcgacgggcgacaagagcaagacgcccgagaccaacgcgccgcagggcaacacc
caatcgggtgacggcaaggacaccgcccgcccggtcccggcgccgcaggtccagccccag
cgtaacgaggtcgcaccgacgcaggcgcccgaggccaagccctcgggggacatcccgacc
aaggcggatccgggctccgagtcgacgccggccaccgagccgccggccaagcccgaccct
gacgcgcccaagccgtaa

DBGET integrated database retrieval system