KEGG   Methylobacterium extorquens PA1: Mext_0341Help
Entry
Mext_0341         CDS       T00640                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mex00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mext_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABY28765
JGI: Mext0341
UniProt: A9VZK9
Position
385520..386437
Genome map
AA seq 305 aa AA seqDB search
MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPVGSAGYPLPDPEPKSGGAAAEAPKA
EPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAAL
KEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLRTLADSPKPLPAAE
KKAETAPAGDKKAETEKPAEGKPDAKKAVEDKKPAGTKPVESATGDKSKTPETNAPQGNT
QSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTKADPGSESTPATEPPAKPDP
DAPKP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagctgaacaaggttgcgggcgcggtcctgggtgccctcctgttcgcg
gttgggtcgggcttcgtggcggagctgatctatcacccgaagcccgtcggaagcgccggc
tatcctctgccggaccccgagccgaagagcggcggcgccgcggcggaagcgccgaaggcc
gagcccatcgccgtgcggctcgccagcgccgatgctgagaagggcaagggcggcaccaag
gcctgccaggcctgccacagcttcgagaagggcggccccaacaaggtcggccccgatctc
tgggagatcgtggagcgcgagaaggcgcatgccgccggcttcgattactccgccgcgctc
aaggagaagggcggcacctggacctacgaggatctcgaccacttcctcgaaagcccgaag
ggctacgtgaagggcaccaagatggcgtttgccggcatcggctcgccgacggaccgcgcc
aacgtcatcgcctatctgcgcacgctcgccgacagcccgaagccgctgccggccgccgag
aagaaggctgaaacggcgccggcaggcgacaagaaggccgagaccgagaagcccgccgag
ggcaagcccgacgccaagaaggccgtcgaggacaagaagcccgccgggaccaagccggtg
gagagcgcgacgggcgacaagagcaagacgcccgagaccaacgcgccgcagggcaacacc
caatcgggtgacggcaaggacaccgcccgcccggtcccggcgccgcaggtccagccccag
cgtaacgaggtcgcaccgacgcaggcgcccgaggccaagccctcgggggacatcccgacc
aaggcggatccgggctccgagtcgacgccggccaccgagccgccggccaagcccgaccct
gacgcgcccaagccgtaa

DBGET integrated database retrieval system