KEGG   Methylobacterium extorquens PA1: Mext_0567Help
Entry
Mext_0567         CDS       T00640                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mext_0567
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mext_0567
Enzymes [BR:mex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mext_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
621266..623701
Genome map
AA seq 811 aa AA seqDB search
MTEPTNPQGRTAPSSAPLGGEELALIDRYWQAANYLSVGQIYLLDNPLLREPLQPQHIKS
RLLGHWGTTPGLNFIYVHLNRLIKARDLDAIYICGPGHGGPGIVANTYLEGTYSEVYPDI
AQDTEGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYAIVHAFGAVFDNPDLIAACV
IGDGEAETGPLAASWQSNKFLSPVTDGAVLPILHLNGYKIANPTVLGRMRDDELESLFTG
FGYEPFFVEGDQPEPMHRAMAEALDRAVARIKDIQAEARGGGMGFRRPRWPMIILRSPKG
WTGPKTVDGKRVEGFWRAHQVPVGNARTDDGHRQILEDWMRSYRPETLFDETGRLRPELA
ALAPEGNRRMSANPHANGGLLRRELRCPRWQDFALTVSMPGAEVGEATRTLGRYLRDVIR
LNAEARNFRIMGPDETASNRLDAVFEATDRVWIENIEPYDVSLAHEGRVMEVLSEHLCQG
WLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKVSRELGWRRPISSLNYLLTSHVWR
QDHNGFSHQDPGFIDLVANKKSDIVRVYLPPDANTLLWVADHCLQTYDRINVIVAGKQPQ
PQWLGAHEAGLHCEAGIGIWSWAGTDETGLEPDVVMACAGDVPTLETLAAVDLLKQAVPG
LRIRVVNVVDLMTLQSNRDHPHGLTDAAFDSLFTRDKPVIFAYHGYPYLIHRLTYSRANH
ANMHVRGFIEEGTTTTPFDMVVLNELDRFHLAIEAIDRVPGLVTRAAGAKQAFRDRLTAH
KLYIREHGEDMPEIQGWKWPYETRQETGTPH
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagccaaccaacccgcaaggacggaccgcgccatcctctgcccccctcggcggc
gaggaactcgccctgatcgaccgctactggcaggcggccaactatctctcggtcggccag
atctacctgctcgacaatccgctgctgcgcgagccgcttcagccgcagcacatcaaatcg
cggctcctcggccactggggcacgacaccggggctgaacttcatctacgtccacctcaac
cggctgatcaaagcccgcgatctcgacgcgatctacatctgcggaccgggccacggcggt
cccggcatcgtcgccaacacctatctcgaaggcacctacagcgaggtctatcccgacatc
gcccaggatacggagggaatgcgccggctgttccggcagttctcgttccccggcggcatc
ccgagccacgtcgcgcccgagacccccggctcgatccacgagggcggtgaactcggctac
gccatcgtccacgccttcggcgcggtgttcgacaatcccgacctgatcgcggcctgcgtg
atcggcgacggcgaggctgagaccgggccgctcgccgcctcgtggcagtccaacaagttt
ctgagcccggtcaccgacggcgcggtgctgccgatcctccacctcaacggctacaagatc
gcaaacccgaccgtgctcggccggatgcgggacgacgagttggagtccttgttcaccggc
ttcggctacgagcctttcttcgtcgagggcgaccaacccgaaccgatgcaccgggcaatg
gccgaggcgctcgaccgcgcggtcgcccgcatcaaggatatccaggccgaggcacggggc
ggcggcatgggcttccggcgcccgcgctggccgatgatcatcctgcgcagccccaagggc
tggaccgggccgaagaccgtggacggcaagcgggtggagggcttctggcgcgcgcaccag
gtgcccgtcggcaacgcccgcaccgatgatggccaccgccagatcctcgaagactggatg
cggagctaccgccccgaaaccctgttcgacgagaccggccgcctgcgccccgaactcgcc
gccctggcgcccgagggcaaccggcgcatgagcgccaacccccacgccaatggcggcctg
ctacgccgggagctgcggtgtccccggtggcaggatttcgccctcacggtgtccatgccc
ggcgccgaagtcggcgaggcgacccgcaccctcgggcggtatttgcgcgacgtgatccgg
ctcaacgccgaggcacgcaacttccgcatcatggggccggacgagaccgcctcgaaccgg
ctcgacgcggtgttcgaggcgaccgaccgcgtctggatcgagaatatcgaaccctatgac
gtcagcctcgcccacgagggccgagtaatggaggtgctgagcgagcatctctgccagggc
tggctcgaaggctacctgctcaccgggcgccacggcctgttctcctgctacgaggccttc
atccacatcgtcgattcgatgttcaaccagcacgccaagtggctgaaggtgtcgcgcgaa
ctcggctggcgccggccgatctcctcgctcaactacctcctgacctcccatgtctggcgc
caggaccataacggattcagccatcaggatccgggcttcatcgacctcgtcgccaacaag
aagtccgacatcgtccgggtctatctgccgccggacgccaacaccctgctctgggtcgcc
gaccactgcctgcagacctatgaccgcatcaacgtgatcgtggccggcaagcagccgcag
ccgcaatggctcggcgcgcacgaggccgggctccattgcgaggcgggcatcggcatctgg
tcctgggccgggacggacgagaccgggctcgaacccgatgtcgtgatggcctgcgccggc
gacgtgccgacgctcgaaaccctggccgccgtcgatctcttgaagcaggccgttcccggc
cttcgcatccgggtcgtcaacgtggtcgacttgatgaccctgcaatcgaacagggatcac
ccgcacgggctgacggatgccgcgttcgacagcctgttcacccgcgataagccggtgatc
ttcgcctatcacggctatccctatctcattcaccggctgacctattcccgggccaaccac
gccaacatgcatgtgcgcggctttatcgaggagggcaccacgacgacgccgttcgacatg
gtggtgctgaacgaactcgaccgcttccacctcgccatcgaagccatcgaccgggtgccg
gggctggtgacgcgggcggcaggggccaagcaggcgttccgggaccgcctgaccgcgcac
aagctctacatccgcgagcacggtgaggacatgcccgagatccagggctggaaatggccc
tacgagacgcgccaggaaaccggaaccccgcactga

DBGET integrated database retrieval system