KEGG   Methylobacterium extorquens PA1: Mext_0733Help
Entry
Mext_0733         CDS       T00640                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_0733
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mext_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
798072..798782
Genome map
AA seq 236 aa AA seqDB search
MRIWVSRPEPGASRTARRLAELSHAALVAPVLRIAPSDGPPPTGRFDGLILTSANAAAPL
AAAGLPEAPVFAVGTRTAERAERAGLRSVHCADGDAVSLARLVAAHVRPGGTLLHAAGED
RKAEPAASLTAAGYGVTTWTAYAALAEATLPEPVVQGLMGRDGAPLAAALHFSRRSAEIA
VHLSGKAGLGGAFRALAHYCLSPDVALGLVELGVAAHFVAARPSEEALLAGLAASD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgggtgtcgcggcccgagccgggcgcgagccgcacggcacggcggctggcc
gaactcagccatgcggcgctggtggcgcccgtgctgcggatcgcgccgagcgacgggccg
ccgcctaccggccggttcgacgggctgatcctgacgagcgccaacgccgccgcgccgctt
gccgcggccggtcttcccgaggcaccggtcttcgcggttggcacccgcaccgccgagcgg
gcggaacgggcgggcctgcgctccgtgcactgtgccgacggggacgccgtcagcctggcc
cggctcgtcgcagcgcatgtgcggccgggcggcacccttctccatgcggccggcgaggac
cgcaaggccgagcccgccgcgagcctcacggctgcgggctacggcgtcacgacctggacc
gcctacgcggctctggccgaggcgaccctgccggagccggtggtgcaggggctgatgggc
cgggacggcgcgccgctcgccgcggccctgcatttttcgcgacggagcgccgaaatcgcg
gtgcatttgtcgggcaaagccggtctgggcggagcgtttcgggcgctggcgcattactgc
ctgtctccggacgtggccttgggactggtcgagctcggcgtcgcggcccattttgtagcg
gcgcgcccgagcgaggaagctctccttgccggtctcgcggcttcggactga

DBGET integrated database retrieval system