KEGG   Methylobacterium extorquens PA1: Mext_0924Help
Entry
Mext_0924         CDS       T00640                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex01100  Metabolic pathways
mex01120  Microbial metabolism in diverse environments
mex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mext_0924
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mext_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Ish1
Motif
Other DBs
NCBI-ProteinID: ABY29329
JGI: Mext0924
UniProt: A9W173
Structure
PDB: 

Jmol
Position
1000469..1000831
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAALALLLPVAAHAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGLTWDEANLKEWLADPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgccctcgcgctgctgctgcctgtcgccgcccatgcc
gagggcgatgccgccgccggcgagaaggcgttcgcgccctgcaaggcctgccacaatttc
gagaagaacggcgtcggcccgaccctgaagggtgtcgtcggcgcgaaggccggcgagggt
gccgacggctacgccttctccgacgcgctgaagaagtccggcctcacctgggatgaagcc
aacctcaaggagtggctcgccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagacgaagtcc
tga

DBGET integrated database retrieval system