KEGG   Methylobacterium extorquens PA1: Mext_0964Help
Entry
Mext_0964         CDS       T00640                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mext_0964
Enzymes [BR:mex01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mext_0964
DNA repair and recombination proteins [BR:mex03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mext_0964
    RecFOR pathway proteins
     Mext_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1045385..1046011
Genome map
AA seq 208 aa AA seqDB search
MIGKLKGIVDSYGEDFVILDVNGVGYVVHCSARTLQRLPKPGEATDLAIETHVREDMIRL
YGFRVDAEREWFRLLQTVQGVGTRVALGVLSVLEPAQLATAIATGDKGAVARAPGVGPRL
AARLVAELKDKAPAFAPIDPALIALTGAVEDRTAPQPVADAISALVNLGYAQIQASAAIA
AALKGLGEEAGTVEAKTLIRLGLRELAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggaatcgtcgattcctacggagaggatttcgtcatcctcgac
gtgaacggcgtcggctacgtcgtccactgctccgcccgcaccctccagcgtctgccgaaa
cccggcgaggcgacggatctcgccatcgagacacatgtgcgtgaggatatgatccgcctc
tacggcttccgcgtcgatgccgagcgggagtggttccgcctgctccagacggtgcagggg
gtcggcacccgcgtggcgctcggcgtgctctcggtgctggagccggcgcagctcgccacc
gccatcgccaccggcgacaagggcgccgtcgcccgcgcccccggcgtcggcccgcggctc
gcggcccgcctcgtcgcggagttgaaggacaaggcgcccgcctttgcccccatcgacccg
gcgctcatcgccttgaccggcgccgtcgaggacaggaccgcgccgcagccggtcgcggac
gcgatctcggccctggtcaatctcggctacgcccagattcaggcttcggccgccatcgcc
gccgccctgaagggcctcggcgaggaggccgggacggtggaggccaagaccctgatccgg
ctcggtctacgggagctggcgcgatag

DBGET integrated database retrieval system