KEGG   Methylobacterium extorquens PA1: Mext_1322Help
Entry
Mext_1322         CDS       T00640                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mext_1322
   01230 Biosynthesis of amino acids
    Mext_1322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_1322
  Energy metabolism
   00680 Methane metabolism
    Mext_1322
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mext_1322
Enzymes [BR:mex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mext_1322
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mext_1322
  Exosomal proteins of melanoma cells
   Mext_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1467633..1468271)
Genome map
AA seq 212 aa AA seqDB search
MDSTTHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLGYRFDHAFTS
RLQRAQHTLALILDELSQTDLPVHADAALNERDYGALAGLNKTEARARFGVEQVRSWRKS
SDAVPPGGESLAMTAARLWPFFERAIAPRVRSGECVLVVAHGNSLRSLLMQLDQVAPADI
EDVNIGTAEMLIYRSNTDDQTLVRAAAIACSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaccacacatactctcgtgctcgtgcggcacggccagagcgaggacaacgag
cgggagctgttttcaggcttgcgagatcctgccctgaccgcgcgcggcgtcaacgaagcg
cgtgccgccggccgcaggctgaagacgctcggatatcgcttcgaccacgcgttcacgagc
cggctccagcgtgctcagcatacgctcgccctgatccttgatgaactgagccaaaccgac
ctgcccgtgcatgcggacgcggccttgaatgaacgagactacggcgcgcttgccggcttg
aacaagacggaggctcgtgcccggttcggcgtcgagcaggtccgctcctggcggaaatct
tccgacgcggtgccgcccggcggcgagagcttggccatgacggcagcgcgcctgtggccg
ttcttcgagcgtgccatcgcacctcgcgttcgaagtggcgaatgcgtgctcgtcgtagct
cacggaaactcgctacgatccctgctcatgcaactcgatcaagtcgcccccgcagacatc
gaagatgtcaacattggtacagcggagatgctcatctaccgcagcaacacagatgatcaa
acgctcgtccgggccgctgcgatcgcttgttcgagctag

DBGET integrated database retrieval system