KEGG   Methylobacterium extorquens PA1: Mext_1369Help
Entry
Mext_1369         CDS       T00640                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1525352..1526611
Genome map
AA seq 419 aa AA seqDB search
MRPPRTPRRIGWAFASALALAAAGSAAAQTTPQPASPQPASPETSSQMPQPAPQPAPQQT
EATTVPPATALPGPPRAETSARTDSGPLLANTLGDDAAWRAYRSRFITEQGRIVDTANGL
ISHSEGQGYGMLLAVAAGDRSTFERIWGWTRANLMVRSDELLAWRWAPDHRPAVSDMNNA
TDGDILVAWALTEAAEAWGEPSYRTAARRIAVEFGRKTILFKDPHGPVLLPAVSGFSARE
RADGPLINLSYWVFPAFQRLPIVAPEYDWASLIRSGVDFLRQSRFGPSSLPTEWISAKDS
LRPADGFPPLFSYNAIRVPLYLAWAGVGRPEDYAPFKTLWGGIERERLPIVDTRDGQPVE
WLSEPGYMAISAITACAADGTPFPEALRTVQDNQNYYPATLQLLSLIAARMRYPSCVKS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccccccgcaccccgcgccgcatcggatgggctttcgcctcggcgctcgccctc
gcggcggccggatccgccgcggcacagacgaccccgcagccggcatccccacagccggcc
tccccggagacgtcgtcccaaatgcctcagcccgcgcctcagcccgcgccccagcagacg
gaggccaccacggtgccccccgccacggccctgccgggcccgccgcgcgccgagacgtcg
gcgcggaccgattccgggccgctcctcgccaacaccctgggcgacgacgcggcatggcgc
gcctaccggtcgcggttcatcaccgagcagggccggatcgtcgataccgccaacggcctg
atcagccacagcgagggccagggctacggcatgctgctcgcggtcgcggccggcgaccgg
tccaccttcgagcggatctggggctggacccgcgccaacctcatggtgcgctccgacgaa
ttgctggcatggcgctgggcgcccgaccaccgcccggcggtctccgacatgaacaacgcc
accgacggcgacatcctggtcgcctgggcgctcaccgaggcagcggaggcctggggcgaa
ccctcctaccgcaccgccgcgcgccgcatcgccgtcgagttcggccgcaagaccatcctg
ttcaaggacccgcacggacccgtcctgctgccggccgtctccggcttctcggcccgcgag
cgcgccgacggcccgctcatcaacctgtcctactgggtcttccccgccttccagcggctg
ccgatcgtcgccccggaatacgattgggcctcgctgatccgcagcggcgtcgatttcctg
cgccagtcccgcttcgggccgagcagcctgccgaccgagtggatctcggccaaggacagc
ttacgccccgccgacggcttcccgccgctattctcctacaacgcgatccgggtgccgctc
tatctcgcctgggccggcgtcgggcggccggaggattacgcgccgttcaagacgctctgg
ggcgggatcgagcgcgagcgcctgccgatcgtcgacacccgcgacgggcagccggtcgag
tggctgagcgagccgggctatatggcgatctccgcgatcaccgcctgcgccgcggacgga
acaccctttccggaagccttaaggacggtgcaggacaatcagaactactatcccgccacc
ctccaactcctctcgctgatcgcggcccggatgcggtatccgtcatgcgtgaaatcctga

DBGET integrated database retrieval system