KEGG   Methylobacterium extorquens PA1: Mext_1369Help
Entry
Mext_1369         CDS       T00640                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mext_1369
Enzymes [BR:mex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mext_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1525352..1526611
Genome map
AA seq 419 aa AA seqDB search
MRPPRTPRRIGWAFASALALAAAGSAAAQTTPQPASPQPASPETSSQMPQPAPQPAPQQT
EATTVPPATALPGPPRAETSARTDSGPLLANTLGDDAAWRAYRSRFITEQGRIVDTANGL
ISHSEGQGYGMLLAVAAGDRSTFERIWGWTRANLMVRSDELLAWRWAPDHRPAVSDMNNA
TDGDILVAWALTEAAEAWGEPSYRTAARRIAVEFGRKTILFKDPHGPVLLPAVSGFSARE
RADGPLINLSYWVFPAFQRLPIVAPEYDWASLIRSGVDFLRQSRFGPSSLPTEWISAKDS
LRPADGFPPLFSYNAIRVPLYLAWAGVGRPEDYAPFKTLWGGIERERLPIVDTRDGQPVE
WLSEPGYMAISAITACAADGTPFPEALRTVQDNQNYYPATLQLLSLIAARMRYPSCVKS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccccccgcaccccgcgccgcatcggatgggctttcgcctcggcgctcgccctc
gcggcggccggatccgccgcggcacagacgaccccgcagccggcatccccacagccggcc
tccccggagacgtcgtcccaaatgcctcagcccgcgcctcagcccgcgccccagcagacg
gaggccaccacggtgccccccgccacggccctgccgggcccgccgcgcgccgagacgtcg
gcgcggaccgattccgggccgctcctcgccaacaccctgggcgacgacgcggcatggcgc
gcctaccggtcgcggttcatcaccgagcagggccggatcgtcgataccgccaacggcctg
atcagccacagcgagggccagggctacggcatgctgctcgcggtcgcggccggcgaccgg
tccaccttcgagcggatctggggctggacccgcgccaacctcatggtgcgctccgacgaa
ttgctggcatggcgctgggcgcccgaccaccgcccggcggtctccgacatgaacaacgcc
accgacggcgacatcctggtcgcctgggcgctcaccgaggcagcggaggcctggggcgaa
ccctcctaccgcaccgccgcgcgccgcatcgccgtcgagttcggccgcaagaccatcctg
ttcaaggacccgcacggacccgtcctgctgccggccgtctccggcttctcggcccgcgag
cgcgccgacggcccgctcatcaacctgtcctactgggtcttccccgccttccagcggctg
ccgatcgtcgccccggaatacgattgggcctcgctgatccgcagcggcgtcgatttcctg
cgccagtcccgcttcgggccgagcagcctgccgaccgagtggatctcggccaaggacagc
ttacgccccgccgacggcttcccgccgctattctcctacaacgcgatccgggtgccgctc
tatctcgcctgggccggcgtcgggcggccggaggattacgcgccgttcaagacgctctgg
ggcgggatcgagcgcgagcgcctgccgatcgtcgacacccgcgacgggcagccggtcgag
tggctgagcgagccgggctatatggcgatctccgcgatcaccgcctgcgccgcggacgga
acaccctttccggaagccttaaggacggtgcaggacaatcagaactactatcccgccacc
ctccaactcctctcgctgatcgcggcccggatgcggtatccgtcatgcgtgaaatcctga

DBGET integrated database retrieval system