KEGG   Methylobacterium extorquens PA1: Mext_1416Help
Entry
Mext_1416         CDS       T00640                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mex  Methylobacterium extorquens PA1
Brite
Enzymes [BR:mex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Mext_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1589390..1589953)
Genome map
AA seq 187 aa AA seqDB search
MDLSAVGRAVLIAREGRRLEAYRDSVGVWTIGIGHTAAAGPPVPRAGLRIEAGEADAIFT
RDVAAFVRTVAEAIPEPLPQHAFDALVSLCFNIGPAAFRRSTVLRRLRAGDRAGAGEAIL
MWNRPAAIIPRRQGEFDQFHTPYETALPRARRSDAQPVAAPVERPSSPSSARPGWRARLW
DWLRAGR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggacctcagtgccgtcggccgcgccgtgctgatcgcccgggaggggcgacggctggaa
gcctaccgcgacagcgtgggggtctggaccatcggcatcggccacaccgccgccgccggg
ccgcccgtgccgcgggcgggcctgcgcatcgaggccggggaggcggacgcgatcttcacc
cgcgacgtggcggccttcgtccgcaccgtcgccgaggcgatccccgagccgctgccgcag
cacgccttcgacgcgctggtctcgctttgcttcaacatcggcccggcggcgttccggcgc
tccacggtgctgcggcgcctgcgggccggcgaccgggcgggcgcgggcgaagcgatcctg
atgtggaaccgcccggccgcgatcatcccccgtcgacagggcgagttcgaccagttccac
acgccctacgaaaccgccctgccgcgcgcccgacgcagcgatgcgcaacccgtcgccgcc
cccgtcgaacgcccatcctcgccgtccagcgcgcggcccggctggcgcgcgcgcctgtgg
gactggctgcgcgccggccgctga

DBGET integrated database retrieval system