KEGG   Methylobacterium extorquens PA1: Mext_1633Help
Entry
Mext_1633         CDS       T00640                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mex01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mex00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1820957..1822168
Genome map
AA seq 403 aa AA seqDB search
MGGAVLPRAIFPEPPVPPLSDHSPLALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVE
RPVFSEPGTPDIQNLYARIGTAGPVLVFAGHTDVVPPGEVGSWTHGPFSGEVAEGFLYGR
GAVDMKGGIACMLAATLAFLDRHGPDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGER
FDHCLLGEPTNPDTLGEMIKIGRRGSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASAL
TADPLDGGTAHFDASNLEFTTIDVGNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRR
LEAAAGNAVRFSLDLQPSNSPAFLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFI
KDACPVIEFGLVGRTMHETDERVAVADLDRLTAIYGRVLDAYF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggagccgtccttccccgagccatctttcccgagccaccggtgccgcccttgtcc
gaccattcccccctcgccctcgcccaggcgctgatccgctgcccctccgtgactccggag
gagggaggggctctgtcgttcctggcggatcgtctttcgcgggcgggcttctcggtcgag
cgtccggtcttctccgagcccggcacgccggacatccagaacctctacgcccggatcggc
accgcagggccggtccttgtctttgccggccataccgacgtggtgccgccgggcgaagtc
ggctcctggacccacgggccgttctcgggcgaagtcgccgagggcttcctctacgggcgc
ggcgcggtggacatgaagggcggcatcgcctgcatgctcgccgcgacgctcgccttcctc
gatcggcacgggccggatttcggcggctccatcgccttcctcgtcaccggcgacgaggag
gggccggcggtcaacggcaccgtgaagctgctcgattgggcgaaggcgaggggcgagcgc
ttcgaccattgcctgctcggcgagccgaccaaccccgacaccctcggcgagatgatcaag
atcggccggcgcggctcgctgaccgggcgcatcaccgtgcacggccgccagggccacgtc
gcctatccgcaccgggccgagaacccgattcccggcctgcttcgcctcgcctcggcgctg
accgccgaccccctcgacggcggcaccgcgcatttcgacgcgtcgaacctcgaattcacg
acgatcgatgtcggcaacccggccaccaacgtgatcccggcctcggccaaggccgtgttt
aacgtgcgcttcaacgatgactggacggcggacaccctcggtgccgagatccggcggcgg
ctggaggcggcggccggcaacgcggtgcggttcagcctcgaccttcagccctcgaactcg
cccgccttcctgacgcagcccgacgccttcgtcgatcgggtggccgatgcgattgaggcc
gagaccggccggcgcccggcgctctccaccacggggggcacctcggacgcccgcttcatc
aaggatgcctgcccggtgatcgagttcggcctcgtcggacggaccatgcacgagaccgac
gagcgggtggcggtagcggatctcgaccggctcaccgcgatctacgggcgggtgctggac
gcttacttctga

DBGET integrated database retrieval system