KEGG   Methylobacterium extorquens PA1: Mext_1644Help
Entry
Mext_1644         CDS       T00640                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mext_1644
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mext_1644
   00640 Propanoate metabolism
    Mext_1644
   00660 C5-Branched dibasic acid metabolism
    Mext_1644
Enzymes [BR:mex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mext_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1834230..1835426
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSRGVPIFKPEEAAAAADELGGPVWVVKSQIHAGGRGKGTFK
GAPEGAKGGVRVTKSKDEVVQFAREMLGQTLVTVQTGEAGKQVNRLYIEEGASIAAEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALGLS
GPQAKEAGALTEKLYAAFTAKDMSMLEINPLVLTGDGGLKCLDAKISFDSNALYRHPEIV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPQVKGILVNIFGGIMKCDVIARGVIAAVKAVGLEVPLVVRLE
GTNVEEGKEIIRNSGLNVIPADDLDDAAQKIVAAVKKG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggcaaaggctgtcctgaaggaattcggcctgccggtctcc
cgcggcgtgccgatcttcaagccggaggaggccgctgcggcggccgacgaactcggcggc
ccggtctgggtggtgaaatcgcagatccatgcgggcgggcgcggcaagggcaccttcaag
ggcgcgcccgagggcgccaagggcggtgtgcgcgtcaccaagtccaaggacgaggtggtg
cagttcgcccgcgagatgctcgggcagacgctcgtgaccgtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggaaggcgcctcgattgccgccgagttctacctg
tcgatgctggtcgatcgcgagaccggccgcgtcgccttcgtcgtctcgacggaaggcggc
atggatatcgagcaggtcgcccacgacacccctgagaagatcgtcaccttctcggtcgat
ccggccaccggcatcatgccccatcacggccgggccgtcgccaaggcgctcgggctctcc
ggtccccaggccaaggaagcgggcgcgctcaccgagaagctctacgcggccttcacggcc
aaggacatgagcatgctggagatcaacccgctggtgctcaccggcgacggcggtctcaag
tgcctcgacgccaagatctcgttcgattcgaacgccctctaccgccaccccgagatcgtc
gcgctgcgcgacgagaccgaggaggacgccaaggagatcgaggcctcgaaatacgacctc
gcctacatcgccctcgacggcaccatcggctgcatggtcaacggcgccggtctcgccatg
gcgacgctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctccgaggagaaggtcacggcggccttcaagatcatcaccgccgatccgcag
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtcatcgcccgc
ggggtgatcgcggcggtgaaggccgtcggcctcgaagtgccgctcgtcgtgcgcctggag
ggtaccaacgtcgaggagggcaaggagatcatccggaactccggcctcaacgtgatcccc
gcggacgatctggatgacgccgcgcagaagatcgtcgccgcggtgaagaagggttga

DBGET integrated database retrieval system