KEGG   Methylobacterium extorquens PA1: Mext_1647Help
Entry
Mext_1647         CDS       T00640                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00020  Citrate cycle (TCA cycle)
mex00310  Lysine degradation
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
Module
mex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mext_1647
  Amino acid metabolism
   00310 Lysine degradation
    Mext_1647
Enzymes [BR:mex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mext_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABY30046
JGI: Mext1647
UniProt: A9W390
Position
1839621..1840949
Genome map
AA seq 442 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAESRTQSREEKGESKPAKDDAPA
QESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAAI
DRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETAAMLT
TFNDVDMGAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVY
KNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGGTFTI
TNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIVDGKE
AVTFLVRVKEALEDPARLVLDL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgacatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagcccctcgtcgaactcgag
accgacaaggtcaccctcgaagtgaacgccccggccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgaggggggc
aagggctcaggaaaatcggatgcgaagcccgctccgaagagcgccgagccggccgagagc
aggacgcaatctcgcgaagagaaaggcgagagcaagcccgccaaggacgacgcgcccgcc
caggaatcctcggcctcctatggcagccacggcgacgccccgcccacggacgggcgcccg
gctgatgacagcggcccggcggtggccaagctcgcccgcgaatccggcatcgacccggcg
agcctcaacggcagcggcaaggacggccgtgtgaccaagggcgacatgctcgccgcgatc
gacaggaacggccagaaggctccggctcaggaagcccgtagcgagacgaaggccccgccg
ccgcgcgccccctccgcgccggacgacgccgcgcgcgaggagcgcgtgcggatgaccaag
ctgcgccagaccatcgccaagcgcctcaagagcgcccaggaaacggcggcgatgctgacc
acgttcaacgacgtggacatgggcgcggtgatggcgatgcgctcgcagtacaaggacatc
ttcgagaagaagcacgggacgaagctcggcttcatgggcttcttcaccaaggcggtgatc
ggcgccctcaaggacgtgccggcggtcaacgccgagatcgacgggcaggatctcgtctac
aagaactactaccacatcggcatcgcggtcggcaccgataagggcctcgtcgtgccggtg
gtgcgcgatgccgacgacctctcgatcgccggaatcgagaagaagatctcgggcttcggc
aagaaggcgcgcgagggcaagctctccatcgacgagatgcagggcggcaccttcaccatc
accaacggcggcatctacggctcgctgatgtcgaccccgatcctcaacgcgccgcaatcg
ggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcaacggcaagatcgag
gcccggccgatgatgtatctggccctttcctacgatcaccgcatcgtcgacgggaaggag
gccgtgaccttcctcgttcgcgtcaaggaagccctggaggatccggcccgcctcgtgctg
gacctgtaa

DBGET integrated database retrieval system