KEGG   Methylobacterium extorquens PA1: Mext_1801Help
Entry
Mext_1801         CDS       T00640                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mext_1801
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mext_1801
   00680 Methane metabolism
    Mext_1801
Enzymes [BR:mex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mext_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2021643..2024411
Genome map
AA seq 922 aa AA seqDB search
MTKTLHARPSAATDTTFAPPVITGTATEDALEILFHALLDVARRHDPELEDVLHGRADIS
SFTPEMLARALQVQGIWFQLVSIAEQNAAMRRRRHVERDQGREALNGSFAKVLAEASARG
IGPQQIHALLKDLRIRPTITAHPTEGKRVTVLEKLRRIYLVLRELELPRWTERERNGLMN
ELRDQIELIWMTGELHLEKATVEREVAWGLHFFDETLFEMLPEMLLSLEESLAQYYPDET
FEVPPFFQFGSWIGGDRDGNPYVTASVTRETLQRNALASLRRYRDGITHLGRVLSITERS
LPVPETFRSELAHMLAESGDARAIANRNPGEAYRQFLSCVLRKLKATIARNKGARSVGPD
YPSADGLINDLRTLEKGLADAKCGALATDIVRPVRRMVEIFRFSTVRLDLRENSTRTTKT
LHALWKLRNGDREPPALDSPAWKDWLLTELARPRTPETSFEDFADRLPDDARETLATFAL
VGEMRDTLDREAFGAFILSMTRSTVDVLGAYLLAKEAGIFLDTTGTEICPLPIVPLFETI
DDLRAAPAIMKELLGIPVVRRSTRWQGGVQEVMIGYSDSNKDGGFIASNWELYKAQVRLT
TLGNHLGVPIAFFHGRGGSVSRGGVPTHRGIAAQPPGSIQGRFRITEQGEVVSFKYANRG
TAAYQMELLAASVFEHALLSEGNGNGSRAEFDDALEALSGASRAAYVNLLQAEGLVDYFQ
AASPLDEISLLNIGSRPARRFGAKSLSDLRAIPWVFAWSQNRHVITGWYGVGSGLKSFID
VRGEAGEALLRRLFRDCRVFRLVLDEVEKTLLMVDLEIARDYAGLVEDEGIRARIFGMIE
AEYALTREMVLRVSGDSELAQRFPQFSERLRGRLPTINQVSREQVELLRRYRSETDEDKR
EAVKSALLLSINCIAVGFGATG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgctgcacgcccggccgtcagccgcgaccgacacgaccttcgcgccgccg
gtcatcaccggcacggccaccgaagacgccctcgagattctgtttcacgccctgctcgat
gtggcccgccgccacgatcccgagctggaagacgtgctgcatggccgcgccgacatctcc
tccttcacgccggagatgctggcgcgcgcgcttcaggtgcagggcatctggtttcagctc
gtctcgatcgccgagcagaatgcggccatgcgccgccgccgccacgtcgagcgcgaccag
ggccgtgaggcgctgaacggctccttcgccaaggttctggccgaggcctccgcccggggc
atcggcccgcagcagatccacgcgctgctcaaggatcttcgcatccgcccgaccatcact
gcgcatcccaccgagggcaagcgcgtcacggtgctggagaagctgcgccggatctacctc
gtgctgcgtgagctggagctgccgcgctggaccgagcgcgagcgcaacggcctgatgaac
gagctgcgcgaccagatcgagctgatctggatgacgggcgagctgcatctggagaaagcc
accgtcgagcgcgaggtcgcctggggcctgcacttcttcgacgagaccctgttcgagatg
ctgcccgagatgctgctctcgctcgaagagagcctcgcgcagtactatcccgacgagacc
ttcgaggtgccgccgttcttccagttcggaagctggatcggcggcgaccgcgacggcaac
ccctacgtcaccgccagcgtcacccgcgagacgcttcagcgcaacgcgctggcgtcgctc
cgccgctaccgcgacggcatcacccatctcggccgggtgctctcgatcaccgagcgctcg
ctgccggtgcccgagaccttccgcagcgaactcgcgcatatgctggccgagtccggcgat
gcgcgggcgatcgccaaccgcaatcccggcgaggcctatcgccagttcctctcctgcgtg
ctgcgcaagctcaaggcgacgatcgcccgcaacaagggcgcccgctcggtcgggccggat
tatccgagcgccgacgggctcatcaacgatctgcgcaccctggagaaggggctggccgac
gccaaatgcggcgcgctcgccaccgatatcgtgcggcccgtgcggcggatggtcgagatc
ttccgcttctccaccgtgcggctcgatctgcgcgagaactcgacccgcaccaccaagacg
ctgcacgcgctgtggaagctgcgcaacggcgaccgcgagccgccggcgctggattcgccg
gcctggaaggattggctgctcaccgagctggcccggccgcgcacgcccgaaacctcgttc
gaggatttcgccgaccgtctgcccgacgacgcgcgcgagacgctcgccaccttcgccctg
gtcggcgagatgcgcgacactctcgaccgcgaggccttcggcgccttcatcctgtcgatg
acgcgctccaccgtcgacgtgctcggcgcctacctgctggccaaggaggccggcatcttc
ctcgacacgaccggcaccgagatctgcccgctgccgatcgtgccgctgttcgagaccatc
gacgacctgcgcgccgccccggcgatcatgaaggaactgctcggcatccccgtggtgcgc
cgctccacccgctggcagggcggggtgcaggaagtgatgatcggctactccgattccaac
aaggacggcggcttcattgcctcgaactgggagctctacaaggcgcaggtgcggctgacc
acgctcggcaaccatctcggcgtgccgatcgccttcttccacggccgcggcggttcggtg
agccgcggcggcgtgccgacccatcgcggcatcgcggcccagccgccgggctcgatccag
ggccgcttccgcatcaccgagcagggcgaagtcgtctcgttcaaatacgccaaccgcggc
accgccgcctaccagatggagctgctggcggcttcggtgttcgagcacgccctgctctcg
gagggcaacggcaacggctcgcgcgccgaattcgacgacgcgctggaggcgctctcgggc
gcctcgcgggcggcctacgtcaacctgctccaggctgagggcctcgtcgattacttccag
gcggcgagcccgctcgacgagatctcgctgctcaatatcggctcgcgcccggcccggcgc
ttcggcgccaagtcgctctcggatctgcgcgcgatcccctgggtgttcgcgtggtcgcag
aaccggcacgtcatcaccggttggtacggcgtcggctcggggctgaagagcttcatcgac
gtgcgcggcgaggcgggcgaagccctgctgaggcgcctgttccgggattgccgggtgttc
cgccttgtcctcgacgaggtcgagaagacgctgctgatggtcgatctcgagatcgcccgc
gactatgccggcctcgtcgaggacgagggcatccgcgcgcgcatcttcgggatgatcgag
gcggaatacgcgctgacgcgggagatggtgctgcgggtgtcgggcgacagcgagctcgcc
cagcgcttcccgcaattcagcgaacgcctgcgcggccggcttccgaccatcaatcaggtc
agccgcgagcaggtcgagctgctgcgccgctaccgcagcgagaccgacgaggacaagcgc
gaggcggtgaagtccgcgctgctgctgtcgatcaactgcatcgccgtcggcttcggcgcg
actggataa

DBGET integrated database retrieval system