KEGG   Methylobacterium extorquens PA1: Mext_1804Help
Entry
Mext_1804         CDS       T00640                                 

Definition
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Mext_1804
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mext_1804
   00623 Toluene degradation
    Mext_1804
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Mext_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2026506..2027381
Genome map
AA seq 291 aa AA seqDB search
MTAFDADLRSLAAQTTFSRRTVIATSLATGFALAVQPVAAQTTITTDTNGLIAGEVKIPT
QDGEIPAYRAMPAEGGPFPTILVVQEIFGVHEHIKDVCRRLAKLGYFALAPELYARQGDV
STLTNIQQIVSEVVSKVPDAQVMSDLDAAVAFAKGTGKADTARLGITGFCWGGRITWLYA
AHDPAVKAGVAWYGRLVGDSSALMPKNPVDVAADLKAPVLGLYGGADQGIPVATIDRMKE
ACRAAGKTCDFVVYPEAGHAFHADYRPSYRAEPAQDGWKRLQDWFRQHGVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttcgatgccgacctgcggagcctcgcggctcagacgactttctcaaggcgc
accgtgatcgccacgagtctcgccacgggcttcgcgctcgccgttcagcccgtcgcggcc
cagaccaccatcaccacggacacgaacggcctgatcgccggcgaggtgaagattccgacg
caggacggtgagatcccggcctaccgggccatgccggccgagggcggccccttcccgacg
atcctggtcgtgcaggaaatcttcggcgtgcacgagcacatcaaggatgtgtgccgccgg
ctggccaagctcggctatttcgccctagcgcccgaactctatgcccggcagggcgacgtc
tcgaccttgaccaacatccagcagatcgtgagcgaggtcgtctccaaggtgcccgacgca
caggtgatgagcgacctcgacgcggcggtcgccttcgccaagggcacgggcaaggccgac
acggcccgcctcgggatcaccggcttctgctggggcgggcgcatcacctggctctacgcc
gcgcacgatccggcggtgaaagccggcgtcgcttggtacgggcggctcgtcggcgacagc
tcggcgctgatgccgaagaaccccgtcgatgtcgccgccgatctcaaggcgccggtgctc
ggcctctatggtggggccgatcagggcatcccggtcgcgacgatcgaccggatgaaggag
gcctgtcgggccgccggaaagacctgcgatttcgttgtctatccggaggcggggcacgcc
ttccatgccgattatcgtccgagctaccgcgcggagccggcacaagacggatggaagcgg
ctacaggactggttccggcagcacggcgtcgcctga

DBGET integrated database retrieval system