KEGG   Methylobacterium extorquens PA1: Mext_1809Help
Entry
Mext_1809         CDS       T00640                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3
Motif
Other DBs
NCBI-ProteinID: ABY30208
JGI: Mext1809
UniProt: A9W3Q2
Position
2031223..2033028
Genome map
AA seq 601 aa AA seqDB search
MRAVHLLALGAGLAAASPALANESVLKGVANPAEQVLQTVDYANTRYSKLDQINASNVKN
LQVAWTFSTGVLRGHEGSPLVVGNIMYVHTPFPNIVYALDLDQGAKIVWKYEPKQDPSVI
PVMCCDTVNRGLAYADGAILLHQADTTLVSLDAKSGKVNWSVKNGDPSKGETNTATVLPV
KDKVIVGISGGEFGVQCHVTAYDLKSGKKVWRGYSIGPDDQLIVDPEKTTSLGKPIGKDS
SLKTWEGDQWKTGGGCTWGWFSYDPKLDLMYYGSGNPSTWNPKQRPGDNKWSMTIWARNP
DTGMAKWVYQMTPHDEWDFDGINEMILTDQKFDGKDRPLLTHFDRNGFGYTLDRATGEVL
VAEKFDPVVNWATKVDLDKGSKTYGRPLVVSKYSTEQNGEDVNSKGICPAALGTKDQQPA
AFSPKTGLFYVPTNHVCMDYEPFRVTYTPGQPYVGATLSMYPAPGSHGGMGNFIAWDNLQ
GKIKWSNPEQFSAWGGALATAGDVVFYGTLEGFLKAVDSKTGKELYKFKTPSGIIGNVMT
YEHKGKQHVAVLSGVGGWAGIGLAAGLTDPNAGLGAVGGYAALSSYTNLGGQLTVFSLPN
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggtacatctcctcgcactcggtgcgggtctcgcggctgcaagcccggccctc
gccaacgaaagcgttctgaagggcgtcgccaacccggcggagcaggtgctccagacggtc
gattacgccaacacccgctattccaagctcgaccagatcaacgccagcaacgtcaagaac
ctccaggttgcctggaccttctcgaccggcgtgctgcgcggccacgagggctccccgctc
gtcgtcggcaacatcatgtacgtccacacccccttcccgaacatcgtctacgcgctggac
ctcgaccagggcgccaagatcgtgtggaagtacgagccgaagcaggatccgtccgtgatc
ccggtcatgtgctgtgacacggtcaaccgtggtctggcctacgccgacggcgcgatcctc
ctgcaccaggccgacaccacgctcgtctcgctcgacgccaagtccggcaaggtgaactgg
tcggtcaagaacggcgacccgtccaagggtgagaccaacaccgccaccgttctcccggtg
aaggacaaggtcatcgtcggcatctccggcggcgagttcggcgtgcagtgccacgtcacc
gcctacgacctgaagtccggcaagaaggtgtggcgcggctactcgatcggcccggacgat
cagctgatcgtcgaccccgagaagaccacctcgctcggcaagccgatcggcaaggactcc
tcgctgaagacctgggaaggcgatcagtggaagaccggcggcggctgcacctggggctgg
ttctcctacgatcccaagctcgacctgatgtattacggctcgggcaacccctccacctgg
aaccccaagcagcgtccgggcgacaacaagtggtcgatgaccatttgggcgcgtaacccc
gacaccggcatggccaagtgggtctaccagatgaccccccacgacgagtgggacttcgac
ggcatcaacgagatgatcctcacggatcagaagttcgacggcaaggaccgtccgctgctg
acgcacttcgatcgtaacggcttcggctacacgctcgaccgcgccaccggtgaagtgctc
gtcgccgagaagttcgatccggttgtgaactgggccaccaaggtcgacctggacaagggt
tccaagacctacggccgtccgctggtcgtgtcgaagtactcgaccgagcagaacggtgaa
gacgtgaactcgaagggcatctgcccggcggctctcggcaccaaggaccagcagccggcg
gccttttcgcccaagaccggcctgttctacgtgcccaccaaccacgtctgcatggactac
gagccgttccgggtgacctacaccccgggccagccctacgtcggtgcgaccctctccatg
tacccggctccgggctcgcatggcggcatgggcaacttcatcgcctgggacaacctccag
ggtaagatcaagtggtccaaccccgagcagttctcggcttggggcggcgcgctcgccact
gccggtgacgtggtgttctacggcacgctcgaaggcttcctgaaggccgtcgactcgaag
acgggtaaggaactgtacaagttcaagaccccgtcgggcatcatcggcaacgtgatgacc
tacgagcacaagggcaagcagcacgtcgccgtcctctccggcgtcggcggctgggccggc
atcggcctcgcggccggcctgaccgacccgaacgccggtctcggcgcggtgggtggctat
gcggccctgtcgagctacaccaacctcggtggccagctcacggtcttctcgctgccgaac
aactaa

DBGET integrated database retrieval system