KEGG   Methylobacterium extorquens PA1: Mext_1816Help
Entry
Mext_1816         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2036901..2037635)
Genome map
AA seq 244 aa AA seqDB search
MRRSFLAVALSAALVTTPSAWAASDTTPAAPQETAAKDPATKGTAPDASDLLFEQPQMKN
TAPGSTLTYDYARRSGIERGPYGPPLSDAIKLTVEPGKSAESRDIRVQMFSGGNRLPAGP
FTDMPGNPVLSLFLENHLKGLASLLEANPRYIKNAIRKGLREKATVTPMQVSFKGRTVEG
WRVEMKPFAGDPQSERMRGFETITYTFVVAPDVPGEIVSIQARALKPDGGELLEERLDYD
QKDS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgagacgatcctttctggcggtcgccctctcggccgcgctcgtgacgacgccttccgcc
tgggcggcttccgacaccaccccagcggcgccgcaagagacggcggccaaagatccggca
accaagggcactgcaccggacgccagcgatctgctgttcgagcagccgcagatgaagaac
accgcgcccggcagcaccctcacctacgattacgcgcgccgcagcggcatcgagcgcggc
ccctacgggccgccgctcagcgacgcgatcaagctcacggtcgagcccggcaagagcgcc
gagagccgcgacatccgcgtgcagatgttctccggcggcaaccgcctcccggccgggccc
ttcaccgacatgcccggcaaccccgtgctgagcctgttcctcgagaaccacctgaagggt
ctcgccagcctgctggaagccaacccgcgctacatcaagaacgcgatccgaaaaggtctg
cgcgagaaggcgacggtgacgccgatgcaggtctcgttcaagggtcggaccgtcgagggc
tggcgcgtcgagatgaagccattcgcgggcgatcctcagtcggagcggatgcgcggcttc
gaaaccatcacctacaccttcgtcgtcgcgcccgacgtgccgggagagatcgtctcgatc
caggcccgggcgctaaagccggatggcggcgaactcctcgaagagaggctcgattatgac
cagaaggattcctga

DBGET integrated database retrieval system