KEGG   Methylobacterium extorquens PA1: Mext_1818Help
Entry
Mext_1818         CDS       T00640                                 

Definition
(GenBank) coenzyme PQQ biosynthesis protein C
  KO
K06137  
pyrroloquinoline-quinone synthase [EC:1.3.3.11]
K06138  
pyrroloquinoline quinone biosynthesis protein D
Organism
mex  Methylobacterium extorquens PA1
Brite
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.11  pyrroloquinoline-quinone synthase
     Mext_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2038783..2039883)
Genome map
AA seq 366 aa AA seqDB search
MTAQFPPPVPDTEQRLLSHEELEAALRDIGARRYHNLHPFHRLLHDGKLSKDQVRAWALN
RYYYQAMIPVKDAALLARLPDAQLRRIWRQRIVDHDGDHEGDGGIERWLKLAEGVGFTRD
YVLSTKGILSATRFSVDAYVHFVSERSLLEAIASSLTEMFSPTIISERVAGMLKNYDFIT
KDTLAYFDKRLTQAPRDADFALDYVKRHATTPEMQRAAMDALTFKCNVLWTQLDALYFAY
VAPGMVPPDAWQPGEGLVAETNSAEASPAATTAEPTAFSGSDVPRLPRGVRLRFDEVRNK
HVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQ
KRVLER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccaattcccgccgcccgtcccggacaccgagcaacgcctgctgagccacgag
gagcttgaggcggcgctccgcgatatcggtgcacggcgctaccacaacctccacccgttc
caccggctgctgcatgacggcaagctgtcgaaggatcaggtccgggcctgggcgctcaac
cgctactattatcaggcgatgattccggtgaaggatgcggcgctcctggcccgcctgccg
gatgcgcagcttcgccggatctggcgccagcgcatcgtcgatcacgacggcgaccatgag
ggcgacggcggcatcgagcgttggctcaagcttgccgaaggcgtcggcttcacccgcgac
tacgtgctctcgaccaagggcatcctgtcggcgacccgcttctcggtcgatgcctatgtc
cacttcgtctccgagcgcagcctgctcgaggccatcgcctcctcgctgaccgagatgttc
tcgccgacgatcatctccgagcgcgtcgccgggatgctgaagaactacgacttcatcacc
aaggacacgctggcctatttcgacaagcgcctgacccaggccccgcgcgacgccgatttc
gccctcgattacgtcaagcggcacgccaccacgccggagatgcagcgggcggcgatggat
gcgttgacgttcaagtgcaacgtgctctggacgcagctcgacgcgctctacttcgcctat
gtcgcccccggcatggtgccgccggatgcgtggcagccgggcgagggcctggtcgccgag
acgaactccgccgaggccagccccgccgcgacgacggctgaacccacggccttctcgggc
agcgacgtgccgcgcctgccccgcggcgtgcgcctgcgcttcgacgaggtccgcaacaag
cacgtgctgctcgcccccgagcgcaccttcgacctcgatgacaacgccgtcgcggttctc
aagctcgtcgatggccggaacacggtttcgcagatcgcccagattctgggccagacctac
gacgccgacccggccatcatcgaagccgacatcctcccgatgctggctggcctcgcgcaa
aaaagggttctggagcgatga

DBGET integrated database retrieval system