KEGG   Methylobacterium extorquens PA1: Mext_1869Help
Entry
Mext_1869         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30268
JGI: Mext1869
UniProt: A9W3W2
Position
2090963..2091214
Genome map
AA seq 83 aa AA seqDB search
MTNLVRFPGGRRIPAATIPRAEFERLAELALDVVDQIVALLNEADGDPELEDGGDAEPSL
GGPKGRASQVGWLRGGDRDLERN
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccttgttcgcttccccggtggccgccgcatcccggctgccaccatcccgcga
gccgagttcgagcggctggccgaacttgccctcgatgtcgtcgaccagatcgttgcgctg
ctcaacgaggccgacggagatccagagcttgaagatggcggcgatgccgagccatccctc
ggcggaccgaagggccgcgcgtctcaggtcggttggctacgtggcggcgaccgggacctc
gaacgcaactaa

DBGET integrated database retrieval system